4v9f

The re-refined crystal structure of the Haloarcula marismortui large ribosomal subunit at 2.4 Angstrom resolution: more complete structure of the L7/L12 and L1 stalk, L5 and LX proteins

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L2P

OrganismNot specified

UniProt P20276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_HALMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–240； UniProt 1–240

50S ribosomal protein L3P

OrganismNot specified

UniProt P20279

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_HALMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–338； UniProt 1–338

50S ribosomal protein L4P

OrganismNot specified

UniProt P12735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_HALMA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246

50S ribosomal protein L5P

OrganismNot specified

UniProt P14124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_HALMA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D； PDBConstruct 1–177； UniProt 1–177

50S ribosomal protein L6P

OrganismNot specified

UniProt P14135

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_HALMA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E； PDBConstruct 1–178； UniProt 1–178

50S ribosomal protein L7Ae

OrganismNot specified

UniProt P12743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_HALMA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain F； PDBConstruct 1–120； UniProt 1–120

50S ribosomal protein L10E

OrganismNot specified

UniProt P15825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLA0_HALMA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–206； UniProt 6–211

50S ribosomal protein L10e

OrganismNot specified

UniProt P60617

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10_HALMA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–177； UniProt 1–177

50S ribosomal protein L11P

OrganismNot specified

UniProt P14122

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL11_HALMA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–162； UniProt 1–162

50S ribosomal protein L13P

OrganismNot specified

UniProt P29198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_HALMA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–145； UniProt 1–145

50S ribosomal protein L14P

OrganismNot specified

UniProt P22450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_HALMA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain K； PDBConstruct 1–132； UniProt 1–132

50S ribosomal protein L15P

OrganismNot specified

UniProt P12737

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_HALMA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain L； PDBConstruct 1–165； UniProt 1–165

50S ribosomal protein L15e

OrganismNot specified

UniProt P60618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_HALMA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain M； PDBConstruct 1–196； UniProt 1–196

50S ribosomal protein L18P

OrganismNot specified

UniProt P14123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_HALMA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain N； PDBConstruct 1–187； UniProt 1–187

50S ribosomal protein L18e

OrganismNot specified

UniProt P12733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_HALMA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain O； PDBConstruct 1–116； UniProt 1–116

50S ribosomal protein L19e

OrganismNot specified

UniProt P14119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19E_HALMA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain P； PDBConstruct 1–149； UniProt 1–149

50S ribosomal protein L21e

OrganismNot specified

UniProt P12734

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_HALMA
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Q； PDBConstruct 1–96； UniProt 1–96

50S ribosomal protein L22P

OrganismNot specified

UniProt P10970

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_HALMA
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain R； PDBConstruct 1–155； UniProt 1–155

50S ribosomal protein L23P

OrganismNot specified

UniProt P12732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_HALMA
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain S； PDBConstruct 1–85； UniProt 1–85

50S ribosomal protein L24P

OrganismNot specified

UniProt P10972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_HALMA
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain T； PDBConstruct 1–120； UniProt 1–120

50S ribosomal protein L24e

OrganismNot specified

UniProt P14116

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_HALMA
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain U； PDBConstruct 1–67； UniProt 1–67

50S ribosomal protein L29P

OrganismNot specified

UniProt P10971

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_HALMA
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain V； PDBConstruct 1–71； UniProt 1–71

50S ribosomal protein L30P

OrganismNot specified

UniProt P14121

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_HALMA
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain W； PDBConstruct 1–154； UniProt 1–154

50S ribosomal protein L31e

OrganismNot specified

UniProt P18138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_HALMA
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain X； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein L32e

OrganismNot specified

UniProt P12736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_HALMA
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain Y； PDBConstruct 1–241； UniProt 1–241

50S ribosomal protein L37Ae

OrganismNot specified

UniProt P60619

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37A_HALMA
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain Z； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein L37e

OrganismNot specified

UniProt P32410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_HALMA
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 1； PDBConstruct 1–57； UniProt 1–57

50S ribosomal protein L39e

OrganismNot specified

UniProt P22452

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_HALMA
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 2； PDBConstruct 1–50； UniProt 1–50

50S ribosomal protein L44e

OrganismNot specified

UniProt P32411

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L12 × 2 50S ribosomal protein LX × 1 （P14125） MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL44E_HALMA
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 3； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein LX

OrganismNot specified

UniProt P14125

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	23S Ribosomal RNA × 1 5S Ribosomal RNA × 1 50S ribosomal protein L2P × 1 （P20276） 50S ribosomal protein L3P × 1 （P20279） 50S ribosomal protein L4P × 1 （P12735） 50S ribosomal protein L5P × 1 （P14124） 50S ribosomal protein L6P × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10E × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11P × 1 （P14122） 50S ribosomal protein L13P × 1 （P29198） 50S ribosomal protein L14P × 1 （P22450） 50S ribosomal protein L15P × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18P × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22P × 1 （P10970） 50S ribosomal protein L23P × 1 （P12732） 50S ribosomal protein L24P × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29P × 1 （P10971） 50S ribosomal protein L30P × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） 50S ribosomal protein L12 × 2 MAGNESIUM ION × 138 POTASSIUM ION × 3 SODIUM ION × 85 CHLORIDE ION × 30 ACETIC ACID × 4 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLX_HALMA
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain 6； PDBConstruct 1–56； UniProt 1–56

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v9f
Deposition date deposition_date	2012-11-02
Structure title title	The re-refined crystal structure of the Haloarcula marismortui large ribosomal subunit at 2.4 Angstrom resolution: more complete structure of the L7/L12 and L1 stalk, L5 and LX proteins
Keywords keywords	50S ribosomal subunit, ribonucleoprotein, ribosomal protein, RNA binding, tRNA binding, metal binding, RIBOSOME; RIBOSOME
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v9f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v9f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v9f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	70.98 Å
Rg (electron density)	72.61 Å
Total Rg	72.32 Å
Atom count	96086
Residues	7236
Excluded volume	1469800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v9f__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	23S Ribosomal RNA
Molecular weight formula_weight	942258.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	0
Atom count atom_count	103831

ACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCCCUCCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAGGUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGC

Entity 2 Entity 2 polymer

Description description	5S Ribosomal RNA
Molecular weight formula_weight	39303.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	9

UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC

Entity 3 Entity 3 polymer

Description description	50S ribosomal protein L2P
Molecular weight formula_weight	25354.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

Entity 4 Entity 4 polymer

Description description	50S ribosomal protein L3P
Molecular weight formula_weight	37396.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG

Entity 5 Entity 5 polymer

Description description	50S ribosomal protein L4P
Molecular weight formula_weight	26457.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER

Entity 6 Entity 6 polymer

Description description	50S ribosomal protein L5P
Molecular weight formula_weight	19551.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEVSE

Entity 7 Entity 7 polymer

Description description	50S ribosomal protein L6P
Molecular weight formula_weight	19961.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKPNRGDA

Entity 8 Entity 8 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	12791.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR

Entity 9 Entity 9 polymer

Description description	50S ribosomal protein L10E
Molecular weight formula_weight	26454.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

ERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	50S ribosomal protein L10e
Molecular weight formula_weight	19942.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEELLIA

Entity 11 Entity 11 polymer

Description description	50S ribosomal protein L11P
Molecular weight formula_weight	17097.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA

Entity 12 Entity 12 polymer

Description description	50S ribosomal protein L13P
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW

Entity 13 Entity 13 polymer

Description description	50S ribosomal protein L14P
Molecular weight formula_weight	14216.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV

Entity 14 Entity 14 polymer

Description description	50S ribosomal protein L15P
Molecular weight formula_weight	18005.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE

Entity 15 Entity 15 polymer

Description description	50S ribosomal protein L15e
Molecular weight formula_weight	22404.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKGK

Entity 16 Entity 16 polymer

Description description	50S ribosomal protein L18P
Molecular weight formula_weight	20640.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL

Entity 17 Entity 17 polymer

Description description	50S ribosomal protein L18e
Molecular weight formula_weight	12438.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR

Entity 18 Entity 18 polymer

Description description	50S ribosomal protein L19e
Molecular weight formula_weight	16796.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA

Entity 19 Entity 19 polymer

Description description	50S ribosomal protein L21e
Molecular weight formula_weight	10567.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE

Entity 20 Entity 20 polymer

Description description	50S ribosomal protein L22P
Molecular weight formula_weight	16966.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED

Entity 21 Entity 21 polymer

Description description	50S ribosomal protein L23P
Molecular weight formula_weight	9612.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRIGVF

Entity 22 Entity 22 polymer

Description description	50S ribosomal protein L24P
Molecular weight formula_weight	13671.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA

Entity 23 Entity 23 polymer

Description description	50S ribosomal protein L24e
Molecular weight formula_weight	7364.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MPRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA

Entity 24 Entity 24 polymer

Description description	50S ribosomal protein L29P
Molecular weight formula_weight	7889.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE

Entity 25 Entity 25 polymer

Description description	50S ribosomal protein L30P
Molecular weight formula_weight	17062.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR

Entity 26 Entity 26 polymer

Description description	50S ribosomal protein L31e
Molecular weight formula_weight	10384.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAETAE

Entity 27 Entity 27 polymer

Description description	50S ribosomal protein L32e
Molecular weight formula_weight	26455.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEVEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

Entity 28 Entity 28 polymer

Description description	50S ribosomal protein L37Ae
Molecular weight formula_weight	10189.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSEDEE

Entity 29 Entity 29 polymer

Description description	50S ribosomal protein L37e
Molecular weight formula_weight	6330.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE

Entity 30 Entity 30 polymer

Description description	50S ribosomal protein L39e
Molecular weight formula_weight	6133.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE

Entity 31 Entity 31 polymer

Description description	50S ribosomal protein L44e
Molecular weight formula_weight	10815.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

Entity 32 Entity 32 polymer

Description description	50S ribosomal protein L12
Molecular weight formula_weight	5975.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,5

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 33 Entity 33 polymer

Description description	50S ribosomal protein LX
Molecular weight formula_weight	6394.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSTYTVRGSFPARDGPQQFEKEVEAPNENVAEERVYSDFGSQHNLKRTQITIEEVA

Entity 34 Entity 34 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	138

Entity 35 Entity 35 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 36 Entity 36 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	85

Entity 37 Entity 37 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	30

Entity 38 Entity 38 non-polymer

Description description	ACETIC ACID
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 39 Entity 39 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 40 Entity 40 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7745

▶

Unit-cell length a length_a	211.660 Å
Unit-cell length b length_b	299.670 Å
Unit-cell length c length_c	573.770 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.404 Å
Low-resolution limit resolution_low	85.478 Å
R factor r_factor	0.1660
R_work r_work	0.1656
R_free r_free	0.2062

The re-refined crystal structure of the Haloarcula marismortui large ribosomal subunit at 2.4 Angstrom resolution: more complete structure of the L7/L12 and L1 stalk, L5 and LX proteins

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L2P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L3P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L4P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L5P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L6P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L7Ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L10E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L10e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L11P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L13P

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer