5bo4

Structure of SOCS2:Elongin C:Elongin B from DMSO-treated crystals

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of cytokine signaling 2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Transcription elongation factor B polypeptide 2 × 1 （Q15370） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Transcription elongation factor B polypeptide 2 × 1 （Q15370） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Transcription elongation factor B polypeptide 2 × 1 （Q15370） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Transcription elongation factor B polypeptide 2 × 1 （Q15370） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Transcription elongation factor B polypeptide 2 × 1 （Q15370） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Transcription elongation factor B polypeptide 2 × 1 （Q15370） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SOCS2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–169； UniProt 32–198 Author chain D； PDBConstruct 3–169； UniProt 32–198 Author chain G； PDBConstruct 3–169； UniProt 32–198 Author chain J； PDBConstruct 3–169； UniProt 32–198 Author chain M； PDBConstruct 3–169； UniProt 32–198 Author chain P； PDBConstruct 3–169； UniProt 32–198

Transcription elongation factor B polypeptide 2

Homo sapiens

UniProt Q15370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 1 × 1 （Q15369） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ELOB_HUMAN
Isoform	Q15370-2
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–104； UniProt 1–104 Author chain E； PDBConstruct 1–104； UniProt 1–104 Author chain H； PDBConstruct 1–104； UniProt 1–104 Author chain K； PDBConstruct 1–104； UniProt 1–104 Author chain N； PDBConstruct 1–104； UniProt 1–104 Author chain Q； PDBConstruct 1–104； UniProt 1–104

Transcription elongation factor B polypeptide 1

Homo sapiens

UniProt Q15369

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 2 × 1 （Q15370） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 2 × 1 （Q15370） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 2 × 1 （Q15370） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 2 × 1 （Q15370） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 2 × 1 （Q15370） water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Suppressor of cytokine signaling 2 × 1 （O14508） Transcription elongation factor B polypeptide 2 × 1 （Q15370） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ELOC_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 2–97； UniProt 17–112 Author chain F； PDBConstruct 2–97； UniProt 17–112 Author chain I； PDBConstruct 2–97； UniProt 17–112 Author chain L； PDBConstruct 2–97； UniProt 17–112 Author chain O； PDBConstruct 2–97； UniProt 17–112 Author chain R； PDBConstruct 2–97； UniProt 17–112

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5bo4
Deposition date deposition_date	2015-05-27
Structure title title	Structure of SOCS2:Elongin C:Elongin B from DMSO-treated crystals
Keywords keywords	Signaling Protein, Ubiquitin Ligase, Suppressor of Cytokine Signalling; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5bo4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5bo4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5bo4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.04 Å
Rg (electron density)	23.06 Å
Total Rg	23.94 Å
Atom count	2530
Residues	340
Excluded volume	45445 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5bo4__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5bo4__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5bo4__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5bo4__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`5bo4__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`5bo4__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Suppressor of cytokine signaling 2
Molecular weight formula_weight	19377.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P
Atom count atom_count	14904

SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Transcription elongation factor B polypeptide 2
Molecular weight formula_weight	11852.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Transcription elongation factor B polypeptide 1
Molecular weight formula_weight	10974.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R

MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	33

▼

6. Fold Classification (SCOP + CATH) 54 domains

SCOP 2.08 (30 domains)

Domain ID domain_id	d5bo4a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d5bo4a2
Class class	a — All alpha proteins
Fold Fold fold	a.271 — SOCS box-like
Superfamily Superfamily superfamily	a.271.1 — SOCS box-like
Family Family family	a.271.1.1 — SOCS box-like

Domain ID domain_id	d5bo4a3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.1 — Ubiquitin-like
Family Family family	d.15.1.1 — Ubiquitin-related

Domain ID domain_id	d5bo4c1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.42 — POZ domain
Superfamily Superfamily superfamily	d.42.1 — POZ domain
Family Family family	d.42.1.1 — BTB/POZ domain

Domain ID domain_id	d5bo4c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4d1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d5bo4d2
Class class	a — All alpha proteins
Fold Fold fold	a.271 — SOCS box-like
Superfamily Superfamily superfamily	a.271.1 — SOCS box-like
Family Family family	a.271.1.1 — SOCS box-like

Domain ID domain_id	d5bo4d3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4e_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.1 — Ubiquitin-like
Family Family family	d.15.1.1 — Ubiquitin-related

Domain ID domain_id	d5bo4f_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.42 — POZ domain
Superfamily Superfamily superfamily	d.42.1 — POZ domain
Family Family family	d.42.1.1 — BTB/POZ domain

Domain ID domain_id	d5bo4g1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d5bo4g2
Class class	a — All alpha proteins
Fold Fold fold	a.271 — SOCS box-like
Superfamily Superfamily superfamily	a.271.1 — SOCS box-like
Family Family family	a.271.1.1 — SOCS box-like

Domain ID domain_id	d5bo4g3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4h_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.1 — Ubiquitin-like
Family Family family	d.15.1.1 — Ubiquitin-related

Domain ID domain_id	d5bo4i1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.42 — POZ domain
Superfamily Superfamily superfamily	d.42.1 — POZ domain
Family Family family	d.42.1.1 — BTB/POZ domain

Domain ID domain_id	d5bo4i2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4j1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d5bo4j2
Class class	a — All alpha proteins
Fold Fold fold	a.271 — SOCS box-like
Superfamily Superfamily superfamily	a.271.1 — SOCS box-like
Family Family family	a.271.1.1 — SOCS box-like

Domain ID domain_id	d5bo4j3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4k_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.1 — Ubiquitin-like
Family Family family	d.15.1.1 — Ubiquitin-related

Domain ID domain_id	d5bo4l1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.42 — POZ domain
Superfamily Superfamily superfamily	d.42.1 — POZ domain
Family Family family	d.42.1.1 — BTB/POZ domain

Domain ID domain_id	d5bo4l2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d5bo4m1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d5bo4m2
Class class	a — All alpha proteins
Fold Fold fold	a.271 — SOCS box-like
Superfamily Superfamily superfamily	a.271.1 — SOCS box-like
Family Family family	a.271.1.1 — SOCS box-like

Domain ID domain_id	d5bo4o_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.42 — POZ domain
Superfamily Superfamily superfamily	d.42.1 — POZ domain
Family Family family	d.42.1.1 — BTB/POZ domain

Domain ID domain_id	d5bo4p1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.93 — SH2-like
Superfamily Superfamily superfamily	d.93.1 — SH2 domain
Family Family family	d.93.1.1 — SH2 domain

Domain ID domain_id	d5bo4p2
Class class	a — All alpha proteins
Fold Fold fold	a.271 — SOCS box-like
Superfamily Superfamily superfamily	a.271.1 — SOCS box-like
Family Family family	a.271.1.1 — SOCS box-like

Domain ID domain_id	d5bo4q_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.15 — beta-Grasp (ubiquitin-like)
Superfamily Superfamily superfamily	d.15.1 — Ubiquitin-like
Family Family family	d.15.1.1 — Ubiquitin-related

Domain ID domain_id	d5bo4r_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.42 — POZ domain
Superfamily Superfamily superfamily	d.42.1 — POZ domain
Family Family family	d.42.1.1 — BTB/POZ domain

CATH v4.4 (24 domains)

Domain ID domain_id	5bo4A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	5bo4A02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	750 — Elongin C; Chain C, domain 1
Homologous superfamily homologous superfamily	20 — SOCS box

Domain ID domain_id	5bo4B00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	5bo4C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	5bo4D01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	5bo4D02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	750 — Elongin C; Chain C, domain 1
Homologous superfamily homologous superfamily	20 — SOCS box

Domain ID domain_id	5bo4E00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	5bo4F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	5bo4G01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	5bo4G02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	750 — Elongin C; Chain C, domain 1
Homologous superfamily homologous superfamily	20 — SOCS box

Domain ID domain_id	5bo4H00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	5bo4I00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	5bo4J01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	5bo4J02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	750 — Elongin C; Chain C, domain 1
Homologous superfamily homologous superfamily	20 — SOCS box

Domain ID domain_id	5bo4K00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	5bo4L00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	5bo4M01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	5bo4M02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	750 — Elongin C; Chain C, domain 1
Homologous superfamily homologous superfamily	20 — SOCS box

Domain ID domain_id	5bo4N00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	5bo4O00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	5bo4P01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	505 — SHC Adaptor Protein
Homologous superfamily homologous superfamily	10 — SH2 domain

Domain ID domain_id	5bo4P02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	750 — Elongin C; Chain C, domain 1
Homologous superfamily homologous superfamily	20 — SOCS box

Domain ID domain_id	5bo4Q00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	5bo4R00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

▶

Unit-cell length a length_a	185.217 Å
Unit-cell length b length_b	185.217 Å
Unit-cell length c length_c	67.204 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 32
Space-group number int_tables_number	145
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	46.300 Å
R factor r_factor	0.2317
R_work r_work	0.2288
R_free r_free	0.2872

Structure of SOCS2:Elongin C:Elongin B from DMSO-treated crystals

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of cytokine signaling 2

State in the Current Structure

Other States of the Same Protein in the Database

Transcription elongation factor B polypeptide 2

State in the Current Structure

Other States of the Same Protein in the Database

Transcription elongation factor B polypeptide 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5bo4__assembly_1__model_1

5bo4__assembly_1__model_1 | I(q)

5bo4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 54 domains

SCOP 2.08 (30 domains)

CATH v4.4 (24 domains)

7. Citations (1)

Structure of SOCS2:Elongin C:Elongin B from DMSO-treated crystals

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of cytokine signaling 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription elongation factor B polypeptide 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription elongation factor B polypeptide 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5bo4__assembly_1__model_1

5bo4__assembly_1__model_1 | I(q)

5bo4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 54 domains

SCOP 2.08 (30 domains)

CATH v4.4 (24 domains)

7. Citations (1)