SAXSdb — 5c3g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bcl-2-like protein 1,Bcl-2-like protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Bcl-2-like protein 11 × 2 （O43521） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2CL1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 27–153； UniProt 83–209

Bcl-2-like protein 1,Bcl-2-like protein 1

Homo sapiens

UniProt Q64373

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Bcl-2-like protein 11 × 2 （O43521） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2CL1_MOUSE
Isoform	Q64373-4
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–26； UniProt 1–26

Bcl-2-like protein 11

OrganismNot specified

UniProt O43521

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Bcl-2-like protein 1,Bcl-2-like protein 1 × 2 （Q07817,Q64373） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2L11_HUMAN
Isoform	O43521-3
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–22； UniProt 56–76

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5c3g
Deposition date deposition_date	2015-06-17
Structure title title	Crystal structure of Bcl-xl bound to BIM-MM
Keywords keywords	Complex, Bcl-2 Family, BH3, Stapled Peptide, apoptosis; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5c3g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5c3g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5c3g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.68 Å
Rg (electron density)	21.76 Å
Total Rg	22.54 Å
Atom count	4892
Residues	304
Excluded volume	44451 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5c3g__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Bcl-2-like protein 1,Bcl-2-like protein 1
Molecular weight formula_weight	17506.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2467

MSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Bcl-2-like protein 11
Molecular weight formula_weight	2611.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

XIWIAQELRLIGDLFNAYYARR

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▶

Unit-cell length a length_a	106.220 Å
Unit-cell length b length_b	106.220 Å
Unit-cell length c length_c	92.760 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 63 2 2
Space-group number int_tables_number	182
Crystal system crystal_system	—

Resolution resolution	2.450 Å
Low-resolution limit resolution_low	34.769 Å
R factor r_factor	0.2268
R_work r_work	0.2244
R_free r_free	0.2735

Crystal structure of Bcl-xl bound to BIM-MM

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bcl-2-like protein 1,Bcl-2-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Bcl-2-like protein 1,Bcl-2-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Bcl-2-like protein 11

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5c3g__assembly_1__model_1

5c3g__assembly_1__model_1 | I(q)

5c3g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of Bcl-xl bound to BIM-MM

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bcl-2-like protein 1,Bcl-2-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bcl-2-like protein 1,Bcl-2-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Bcl-2-like protein 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5c3g__assembly_1__model_1

5c3g__assembly_1__model_1 | I(q)

5c3g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)