5ivw

Human core TFIIH bound to DNA within the PIC

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TFIIH basal transcription factor complex helicase XPB subunit

OrganismNot specified

UniProt P19447

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 2	TFIIH basal transcription factor complex helicase XPD subunit × 1 （P18074） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 3 × 1 （Q13889） scp-X × 1 scp-Y × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERCC3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain V； PDBConstruct 1–782； UniProt 1–782

TFIIH basal transcription factor complex helicase XPD subunit

OrganismNot specified

UniProt P18074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 3 × 1 （Q13889） scp-X × 1 scp-Y × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERCC2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain W； PDBConstruct 1–760； UniProt 1–760

General transcription factor IIH subunit 2

OrganismNot specified

UniProt Q13888

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） TFIIH basal transcription factor complex helicase XPD subunit × 1 （P18074） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 3 × 1 （Q13889） scp-X × 1 scp-Y × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 0； PDBConstruct 1–395； UniProt 1–395

General transcription factor IIH subunit 5

OrganismNot specified

UniProt Q6ZYL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） TFIIH basal transcription factor complex helicase XPD subunit × 1 （P18074） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 3 × 1 （Q13889） scp-X × 1 scp-Y × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 1； PDBConstruct 1–71； UniProt 1–71

General transcription factor IIH subunit 4

OrganismNot specified

UniProt Q92759

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） TFIIH basal transcription factor complex helicase XPD subunit × 1 （P18074） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription factor IIH subunit 3 × 1 （Q13889） scp-X × 1 scp-Y × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 2； PDBConstruct 1–462； UniProt 1–462

General transcription factor IIH subunit 3

OrganismNot specified

UniProt Q13889

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 6 DNA 2	TFIIH basal transcription factor complex helicase XPB subunit × 1 （P19447） TFIIH basal transcription factor complex helicase XPD subunit × 1 （P18074） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription factor IIH subunit 4 × 1 （Q92759） scp-X × 1 scp-Y × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 3； PDBConstruct 1–308； UniProt 1–308

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5ivw
Deposition date deposition_date	2016-03-21
Structure title title	Human core TFIIH bound to DNA within the PIC
Keywords keywords	initiation, RNA polymerase II, human, TRANSCRIPTION-DNA complex; TRANSCRIPTION/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5ivw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5ivw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5ivw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.73 Å
Rg (electron density)	53.43 Å
Total Rg	53.49 Å
Atom count	15688
Residues	1896
Excluded volume	278930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5ivw__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	TFIIH basal transcription factor complex helicase XPB subunit
Molecular weight formula_weight	89404.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V
Atom count atom_count	15688

MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK

Entity 2 Entity 2 polymer

Description description	TFIIH basal transcription factor complex helicase XPD subunit
Molecular weight formula_weight	87021.1 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL

Entity 3 Entity 3 polymer

Description description	General transcription factor IIH subunit 2
Molecular weight formula_weight	44482.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Entity 4 Entity 4 polymer

Description description	General transcription factor IIH subunit 5
Molecular weight formula_weight	8060.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Entity 5 Entity 5 polymer

Description description	General transcription factor IIH subunit 4
Molecular weight formula_weight	52245.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS

Entity 6 Entity 6 polymer

Description description	General transcription factor IIH subunit 3
Molecular weight formula_weight	34416.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA

Entity 7 Entity 7 polymer

Description description	scp-X
Molecular weight formula_weight	5879.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

ATTGCCGAAGACGAAAAAA

Entity 8 Entity 8 polymer

Description description	scp-Y
Molecular weight formula_weight	6071.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

TTTTTTTCGTCTTCGGCAAT

▶

Resolution resolution	10.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	219771

Human core TFIIH bound to DNA within the PIC

1. Protein Identity and Related Structures Protein Identity & Related Structures

TFIIH basal transcription factor complex helicase XPB subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TFIIH basal transcription factor complex helicase XPD subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5ivw__assembly_1__model_1

5ivw__assembly_1__model_1 | I(q)

5ivw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

7. Citations (1)