5mdx

Cryo-EM structure of the PSII supercomplex from Arabidopsis thaliana

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–343； UniProt 2–344 Author chain a； PDBConstruct 1–343； UniProt 2–344

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt P56777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–507； UniProt 2–508 Author chain b； PDBConstruct 1–507； UniProt 2–508

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P56778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–459； UniProt 15–473 Author chain c； PDBConstruct 1–459； UniProt 15–473

Photosystem II D2 protein

OrganismNot specified

UniProt P56761

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 2–353 Author chain d； PDBConstruct 1–352； UniProt 2–353

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P56779

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–83； UniProt 1–83 Author chain e； PDBConstruct 1–83； UniProt 1–83

Cytochrome b559 subunit beta (PsbF)

OrganismNot specified

UniProt P62095

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–39； UniProt 1–39 Author chain f； PDBConstruct 1–39； UniProt 1–39

Photosystem II reaction center protein H

OrganismNot specified

UniProt P56780

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–72； UniProt 2–73 Author chain h； PDBConstruct 1–72； UniProt 2–73

Photosystem II reaction center protein I

OrganismNot specified

UniProt P62100

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_ARATH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36 Author chain i； PDBConstruct 1–36； UniProt 1–36

Photosystem II reaction center protein K

OrganismNot specified

UniProt P56782

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_ARATH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 25–61 Author chain k； PDBConstruct 1–37； UniProt 25–61

Photosystem II reaction center protein L

OrganismNot specified

UniProt P60129

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_ARATH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P62109

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_ARATH
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–34； UniProt 1–34 Author chain m； PDBConstruct 1–34； UniProt 1–34

Oxygen-evolving enhancer protein 1-1, chloroplastic

OrganismNot specified

UniProt P23321

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO1_ARATH
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–247； UniProt 86–332 Author chain o； PDBConstruct 1–247； UniProt 86–332

Photosystem II reaction center protein T

OrganismNot specified

UniProt P61839

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_ARATH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain T； PDBConstruct 1–33； UniProt 1–33 Author chain t； PDBConstruct 1–33； UniProt 1–33

Photosystem II reaction center W protein, chloroplastic

OrganismNot specified

UniProt Q39194

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBW_ARATH
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain W； PDBConstruct 1–54； UniProt 80–133 Author chain w； PDBConstruct 1–54； UniProt 80–133

Photosystem II reaction center protein X

OrganismNot specified

UniProt Q9SKI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9SKI3_ARATH
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain X； PDBConstruct 1–116； UniProt 1–116 Author chain x； PDBConstruct 1–116； UniProt 1–116

Photosystem II reaction center protein Z

OrganismNot specified

UniProt P56790

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_ARATH
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

Chlorophyll a-b binding protein CP29.1, chloroplastic

OrganismNot specified

UniProt Q07473

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB4A_ARATH
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain R； PDBConstruct 1–250； UniProt 41–290 Author chain r； PDBConstruct 1–250； UniProt 41–290

Chlorophyll a-b binding protein CP26, chloroplastic

OrganismNot specified

UniProt Q9XF89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB5_ARATH
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain S； PDBConstruct 1–232； UniProt 49–280 Author chain s； PDBConstruct 1–232； UniProt 49–280

Chlorophyll a-b binding protein 1, chloroplastic

OrganismNot specified

UniProt P04778

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9LMQ2） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB1C_ARATH
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 1； PDBConstruct 1–224； UniProt 44–267 Author chain 2； PDBConstruct 1–224； UniProt 44–267 Author chain 3； PDBConstruct 1–224； UniProt 44–267 Author chain 5； PDBConstruct 1–224； UniProt 44–267 Author chain 6； PDBConstruct 1–224； UniProt 44–267 Author chain 7； PDBConstruct 1–224； UniProt 44–267 Author chain G； PDBConstruct 1–224； UniProt 44–267 Author chain N； PDBConstruct 1–224； UniProt 44–267 Author chain Y； PDBConstruct 1–224； UniProt 44–267 Author chain g； PDBConstruct 1–224； UniProt 44–267 Author chain n； PDBConstruct 1–224； UniProt 44–267 Author chain y； PDBConstruct 1–224； UniProt 44–267

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q9LMQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 50	Photosystem II protein D1 × 2 （P83755） Photosystem II CP47 reaction center protein × 2 （P56777） Photosystem II CP43 reaction center protein × 2 （P56778） Photosystem II D2 protein × 2 （P56761） Cytochrome b559 subunit alpha × 2 （P56779） Cytochrome b559 subunit beta (PsbF) × 2 （P62095） Photosystem II reaction center protein H × 2 （P56780） Photosystem II reaction center protein I × 2 （P62100） Photosystem II reaction center protein K × 2 （P56782） Photosystem II reaction center protein L × 2 （P60129） Photosystem II reaction center protein M × 2 （P62109） Oxygen-evolving enhancer protein 1-1, chloroplastic × 2 （P23321） Photosystem II reaction center protein T × 2 （P61839） Photosystem II reaction center W protein, chloroplastic × 2 （Q39194） Photosystem II reaction center protein X × 2 （Q9SKI3） Photosystem II reaction center protein Z × 2 （P56790） Chlorophyll a-b binding protein CP29.1, chloroplastic × 2 （Q07473） Chlorophyll a-b binding protein CP26, chloroplastic × 2 （Q9XF89） Chlorophyll a-b binding protein 1, chloroplastic × 12 （P04778） FE (II) ION × 2 CHLOROPHYLL A × 212 PHEOPHYTIN A × 4 PROTOPORPHYRIN IX CONTAINING FE × 2 CHLOROPHYLL B × 96	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9LMQ2_ARATH
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 4； PDBConstruct 1–210； UniProt 48–257 Author chain 8； PDBConstruct 1–210； UniProt 48–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5mdx
Deposition date deposition_date	2016-11-13
Structure title title	Cryo-EM structure of the PSII supercomplex from Arabidopsis thaliana
Keywords keywords	photosynthesis, photosystem II supercomplex, single particle analysis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5mdx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5mdx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5mdx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.67 Å
Rg (electron density)	88.35 Å
Total Rg	87.80 Å
Atom count	78322
Residues	8270
Excluded volume	1407100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5mdx__assembly_1__model_1`	50-meric （50）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (25)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	38003.2 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	78324

TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Entity 2 Entity 2 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	55960.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

GLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGDPTTKRQAV

Entity 3 Entity 3 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	50086.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGGDVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILTKPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN

Entity 4 Entity 4 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39444.1 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

TIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9393.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRSF

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit beta (PsbF)
Molecular weight formula_weight	4428.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7575.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

ATQTVEDSSRSGPRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVN

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4170.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	4239.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

KLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVSFR

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4471.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MTQSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3783.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

Entity 12 Entity 12 polymer

Description description	Oxygen-evolving enhancer protein 1-1, chloroplastic
Molecular weight formula_weight	26594.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

EGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3825.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MEALVYTFLLVSTLGIIFFAIFFREPPKISTKK

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center W protein, chloroplastic
Molecular weight formula_weight	6036.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w

LVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEESGLSL

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center protein X
Molecular weight formula_weight	11826.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

MASTSAMSLVTPLNQTRSSPFLKPLPLKPSKALVATGGRAQRLQVKALKMDKALTGISAAALTASMVIPEIAEAAGSGISPSLKNFLLSIASGGLVLTVIIGVVVGVSNFDPVKRT

Entity 16 Entity 16 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6569.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTIAFQLAVFALIITSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein CP29.1, chloroplastic
Molecular weight formula_weight	27302.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

AAPKKSAKKTVTTDRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAKSTPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein CP26, chloroplastic
Molecular weight formula_weight	25232.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL

Entity 19 Entity 19 polymer

Description description	Chlorophyll a-b binding protein 1, chloroplastic
Molecular weight formula_weight	23971.9 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,N,Y,g,n,y,1,2,3,5,6,7

GPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK

Entity 20 Entity 20 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23014.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,8

AAAAQPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGVAWFEAGAQPDAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPDSQSVEWATPWSKTAENFANYTGDQGYPGGRFFDPLGLAGKNRDGVYEPDFEKLERLKLAEIKHSRLAMVAMLIFYFEAGQGKTPLGALG

Entity 21 Entity 21 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	212

Entity 23 Entity 23 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 24 Entity 24 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	96

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	23434

Cryo-EM structure of the PSII supercomplex from Arabidopsis thaliana

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta (PsbF)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer