5mpe

26S proteasome in presence of ATP (s2)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome regulatory subunit RPN10

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN10_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain W； PDBConstruct 1–268； UniProt 1–268

Ubiquitin carboxyl-terminal hydrolase RPN11

OrganismNot specified

UniProt P43588

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN11_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain V； PDBConstruct 1–306； UniProt 1–306

26S proteasome regulatory subunit RPN12

OrganismNot specified

UniProt P32496

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN12_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain T； PDBConstruct 1–274； UniProt 1–274

26S proteasome regulatory subunit RPN13

OrganismNot specified

UniProt O13563

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN13_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain X； PDBConstruct 1–156； UniProt 1–156

26S proteasome complex subunit SEM1

OrganismNot specified

UniProt O94742

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEM1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Y； PDBConstruct 1–89； UniProt 1–89

26S proteasome regulatory subunit RPN1

OrganismNot specified

UniProt P38764

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Z； PDBConstruct 1–993； UniProt 1–993

26S proteasome regulatory subunit RPN2

OrganismNot specified

UniProt P32565

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN2_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–945； UniProt 1–945

26S proteasome regulatory subunit RPN3

OrganismNot specified

UniProt P40016

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN3_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain S； PDBConstruct 1–523； UniProt 1–523

26S proteasome regulatory subunit RPN5

OrganismNot specified

UniProt Q12250

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN5_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–445； UniProt 1–445

26S proteasome regulatory subunit RPN6

OrganismNot specified

UniProt Q12377

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN6_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–434； UniProt 1–434

26S proteasome regulatory subunit RPN7

OrganismNot specified

UniProt Q06103

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN7_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain R； PDBConstruct 1–429； UniProt 1–429

26S proteasome regulatory subunit RPN8

OrganismNot specified

UniProt Q08723

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN9 × 1 （Q04062）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN8_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain U； PDBConstruct 1–338； UniProt 1–338

26S proteasome regulatory subunit RPN9

OrganismNot specified

UniProt Q04062

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN9_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–393； UniProt 1–393

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5mpe
Deposition date deposition_date	2016-12-16
Structure title title	26S proteasome in presence of ATP (s2)
Keywords keywords	Macromolecular complex, 26S proteasome, Protease, hydrolase; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5mpe__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5mpe__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5mpe__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.60 Å
Rg (electron density)	73.34 Å
Total Rg	73.34 Å
Atom count	40974
Residues	5142
Excluded volume	733170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5mpe__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5mpe__assembly_2__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	26S proteasome regulatory subunit RPN10
Molecular weight formula_weight	29776.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W
Atom count atom_count	40974

MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSSGMGAFGGSGGDSDANGTFMDFGVDPSMDPELAMALRLSMEEEQQRQERLRQQQQQQDQPEQSEQPEQHQDK

Entity 2 Entity 2 polymer

Description description	Ubiquitin carboxyl-terminal hydrolase RPN11
Molecular weight formula_weight	34442.3 kDa
EC 编号 ec_number	3.4.19.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK

Entity 3 Entity 3 polymer

Description description	26S proteasome regulatory subunit RPN12
Molecular weight formula_weight	31952.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV

Entity 4 Entity 4 polymer

Description description	26S proteasome regulatory subunit RPN13
Molecular weight formula_weight	17919.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD

Entity 5 Entity 5 polymer

Description description	26S proteasome complex subunit SEM1
Molecular weight formula_weight	10397.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ

Entity 6 Entity 6 polymer

Description description	26S proteasome regulatory subunit RPN1
Molecular weight formula_weight	109601.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MVDESDKKQQTIDEQSQISPEKQTPNKKDKKKEEEEQLSEEDAKLKTDLELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPKNVKGEEDADEEETAEGQTNSISDFLGEQVNEPTKNEEAEIEVDEMEVDAEGEEVEVKAEITEKKNGESLEGEEIKSEEKKGKSSDKDATTDGKNDDEEEEKEAGIVDELAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE

Entity 7 Entity 7 polymer

Description description	26S proteasome regulatory subunit RPN2
Molecular weight formula_weight	104351.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSLTTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVALIETVRQMKDVNAPLPTPFKVDDNVDFPSA

Entity 8 Entity 8 polymer

Description description	26S proteasome regulatory subunit RPN3
Molecular weight formula_weight	60464.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MASTAVMMDVDSSGVNDLHHSEKKYAEEDQVQELLKVLNEISKTTLTLDPRYIWRSLKDLSSLRNQELLNAETLCFTVNVLYPDSSSFKKNLLKFITSNHKSSVPGSAELRNSYPASFYSVNTEKKTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGFL

Entity 9 Entity 9 polymer

Description description	26S proteasome regulatory subunit RPN5
Molecular weight formula_weight	51840.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK

Entity 10 Entity 10 polymer

Description description	26S proteasome regulatory subunit RPN6
Molecular weight formula_weight	49839.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY

Entity 11 Entity 11 polymer

Description description	26S proteasome regulatory subunit RPN7
Molecular weight formula_weight	49016.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV

Entity 12 Entity 12 polymer

Description description	26S proteasome regulatory subunit RPN8
Molecular weight formula_weight	38365.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN

Entity 13 Entity 13 polymer

Description description	26S proteasome regulatory subunit RPN9
Molecular weight formula_weight	45839.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	193337

26S proteasome in presence of ATP (s2)

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome regulatory subunit RPN10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquitin carboxyl-terminal hydrolase RPN11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome complex subunit SEM1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer