3jck

Structure of the yeast 26S proteasome lid sub-complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome regulatory subunit RPN3

Saccharomyces cerevisiae S288c

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 46–438； UniProt 131–523

26S proteasome regulatory subunit RPN5

Saccharomyces cerevisiae S288c

UniProt Q12250

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN5_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–445； UniProt 1–445

26S proteasome regulatory subunit RPN6

Saccharomyces cerevisiae S288c

UniProt Q12377

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN6_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–434； UniProt 1–434

26S proteasome regulatory subunit RPN7

Saccharomyces cerevisiae S288c

UniProt Q06103

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN7_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–429； UniProt 1–429

26S proteasome regulatory subunit RPN8

Saccharomyces cerevisiae S288c

UniProt Q08723

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN8_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–338； UniProt 1–338

26S proteasome regulatory subunit RPN9

Saccharomyces cerevisiae S288c

UniProt Q04062

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN9_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–393； UniProt 1–393

Ubiquitin carboxyl-terminal hydrolase RPN11

Saccharomyces cerevisiae S288c

UniProt P43588

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN11_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–306； UniProt 1–306

26S proteasome regulatory subunit RPN12

Saccharomyces cerevisiae S288c

UniProt P32496

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome complex subunit SEM1 × 1 （O94742） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN12_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–274； UniProt 1–274

26S proteasome complex subunit SEM1

Saccharomyces cerevisiae S288c

UniProt O94742

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEM1_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–89； UniProt 1–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3jck
Deposition date deposition_date	2015-12-20
Structure title title	Structure of the yeast 26S proteasome lid sub-complex
Keywords keywords	Proteasome, deubiquitinase, Rpn11, protein homeostasis, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3jck__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3jck__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3jck__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.78 Å
Rg (electron density)	56.02 Å
Total Rg	56.02 Å
Atom count	22456
Residues	2777
Excluded volume	402930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3jck__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	2	`3jck__assembly_1__model_2`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	3	`3jck__assembly_1__model_3`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	4	`3jck__assembly_1__model_4`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
1	5	`3jck__assembly_1__model_5`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	26S proteasome regulatory subunit RPN3
Molecular weight formula_weight	49573.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	112285

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGFL

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	26S proteasome regulatory subunit RPN5
Molecular weight formula_weight	51840.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	26S proteasome regulatory subunit RPN6
Molecular weight formula_weight	49839.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	26S proteasome regulatory subunit RPN7
Molecular weight formula_weight	49016.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	26S proteasome regulatory subunit RPN8
Molecular weight formula_weight	38365.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	26S proteasome regulatory subunit RPN9
Molecular weight formula_weight	45839.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 7 Entity 7 polymer

Description description	Ubiquitin carboxyl-terminal hydrolase RPN11
Molecular weight formula_weight	34442.3 kDa
EC 编号 ec_number	3.4.19.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 8 Entity 8 polymer

Description description	26S proteasome regulatory subunit RPN12
Molecular weight formula_weight	31952.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPSLAELTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIENIV

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 9 Entity 9 polymer

Description description	26S proteasome complex subunit SEM1
Molecular weight formula_weight	10397.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 10 Entity 10 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3jckC00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	570 —

Domain ID domain_id	3jckE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	140 — Cytidine Deaminase; domain 2
Homologous superfamily homologous superfamily	10 — Cytidine Deaminase, domain 2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	projection matching
颗粒数 num_particles	109396

Structure of the yeast 26S proteasome lid sub-complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

26S proteasome regulatory subunit RPN3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquitin carboxyl-terminal hydrolase RPN11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit RPN12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome complex subunit SEM1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3jck__assembly_1__model_1

3jck__assembly_1__model_1 | I(q)

3jck__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment