6ef3

Yeast 26S proteasome bound to ubiquitinated substrate (4D motor state)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit beta type-1

Saccharomyces cerevisiae S288c

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–215； UniProt 1–215

Proteasome subunit beta type-2

Saccharomyces cerevisiae S288c

UniProt P25043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit beta type-3

Saccharomyces cerevisiae S288c

UniProt P25451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta type-4

Saccharomyces cerevisiae S288c

UniProt P22141

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–198； UniProt 1–198

Proteasome subunit beta type-5

Saccharomyces cerevisiae S288c

UniProt P30656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 5； PDBConstruct 1–287； UniProt 1–287

Proteasome subunit beta type-6

Saccharomyces cerevisiae S288c

UniProt P23724

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 6； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit beta type-7

Saccharomyces cerevisiae S288c

UniProt P30657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 7； PDBConstruct 1–266； UniProt 1–266

Proteasome subunit alpha type-1

Saccharomyces cerevisiae S288c

UniProt P21243

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–252； UniProt 1–252

Proteasome subunit alpha type-2

Saccharomyces cerevisiae S288c

UniProt P23639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B； PDBConstruct 1–250； UniProt 1–250

Proteasome subunit alpha type-3

Saccharomyces cerevisiae S288c

UniProt P23638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain C； PDBConstruct 1–258； UniProt 1–258

Proteasome subunit alpha type-4

Saccharomyces cerevisiae S288c

UniProt P40303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain D； PDBConstruct 1–254； UniProt 1–254

Proteasome subunit alpha type-5

Saccharomyces cerevisiae S288c

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain E； PDBConstruct 1–260； UniProt 1–260

Proteasome subunit alpha type-6

Saccharomyces cerevisiae S288c

UniProt P40302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain F； PDBConstruct 1–234； UniProt 1–234

Probable proteasome subunit alpha type-7

Saccharomyces cerevisiae S288c

UniProt P21242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain G； PDBConstruct 1–288； UniProt 1–288

26S proteasome regulatory subunit 7 homolog

Saccharomyces cerevisiae S288c

UniProt P33299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain H； PDBConstruct 1–467； UniProt 1–467

26S proteasome regulatory subunit 4 homolog

Saccharomyces cerevisiae S288c

UniProt P40327

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain I； PDBConstruct 1–437； UniProt 1–437

26S proteasome regulatory subunit 8 homolog

Saccharomyces cerevisiae S288c

UniProt Q01939

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain J； PDBConstruct 1–405； UniProt 1–405

26S proteasome regulatory subunit 6B homolog

Saccharomyces cerevisiae S288c

UniProt P33298

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain K； PDBConstruct 1–428； UniProt 1–428

26S proteasome subunit RPT4

Saccharomyces cerevisiae S288c

UniProt P53549

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS10_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain L； PDBConstruct 1–437； UniProt 1–437

26S proteasome regulatory subunit 6A

Saccharomyces cerevisiae S288c

UniProt P33297

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6A_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain M； PDBConstruct 1–434； UniProt 1–434

Ubiquitin carboxyl-terminal hydrolase RPN11

Saccharomyces cerevisiae S288c

UniProt P43588

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Model substrate polypeptide × 1 Ubiquitin-60S ribosomal protein L40 × 1 （P0CH08） ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN11_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain r； PDBConstruct 1–306； UniProt 1–306

Ubiquitin-60S ribosomal protein L40

Saccharomyces cerevisiae S288c

UniProt P0CH08

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Proteasome subunit beta type-1 × 1 （P38624） Proteasome subunit beta type-2 × 1 （P25043） Proteasome subunit beta type-3 × 1 （P25451） Proteasome subunit beta type-4 × 1 （P22141） Proteasome subunit beta type-5 × 1 （P30656） Proteasome subunit beta type-6 × 1 （P23724） Proteasome subunit beta type-7 × 1 （P30657） Proteasome subunit alpha type-1 × 1 （P21243） Proteasome subunit alpha type-2 × 1 （P23639） Proteasome subunit alpha type-3 × 1 （P23638） Proteasome subunit alpha type-4 × 1 （P40303） Proteasome subunit alpha type-5 × 1 （P32379） Proteasome subunit alpha type-6 × 1 （P40302） Probable proteasome subunit alpha type-7 × 1 （P21242） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） Proteasome subunit beta type-7 × 1 Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） Model substrate polypeptide × 1 ADENOSINE-5'-TRIPHOSPHATE × 4 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL40A_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain u； PDBConstruct 1–128； UniProt 1–128

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ef3
Deposition date deposition_date	2018-08-15
Structure title title	Yeast 26S proteasome bound to ubiquitinated substrate (4D motor state)
Keywords keywords	26S Proteasome, ATPase, AAA+, Protease, Motor protein, Ubiquitin; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ef3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ef3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ef3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.40 Å
Rg (electron density)	61.42 Å
Total Rg	61.53 Å
Atom count	44271
Residues	5824
Excluded volume	788030 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ef3__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (26)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	23573.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	44271

MNGIQVDINRLKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 2 Entity 2 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	28299.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MAGLSFDNYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 3 Entity 3 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22627.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 4 Entity 4 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	22545.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 5 Entity 5 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	31670.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MQAIADSFSVPNRLVKELQYDNEQNLESDFVTGASQFQRLAPSLTVPPIASPQQFLRAHTDDSRNPDCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 6 Entity 6 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	26905.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MATIASEYSSEASNTPIEHQFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 7 Entity 7 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	29471.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MNHDPFSWGRPADSTYGAYNTQIANAGASPMVNTQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 8 Entity 8 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	28033.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 9 Entity 9 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	27191.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 10 Entity 10 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28748.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDEEADEDMK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 11 Entity 11 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	28478.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 12 Entity 12 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	28649.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAESPEEADVEMS

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 13 Entity 13 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	25634.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 14 Entity 14 polymer

Description description	Probable proteasome subunit alpha type-7
Molecular weight formula_weight	31575.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 15 Entity 15 polymer

Description description	26S proteasome regulatory subunit 7 homolog
Molecular weight formula_weight	52054.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 16 Entity 16 polymer

Description description	26S proteasome regulatory subunit 4 homolog
Molecular weight formula_weight	48898.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEKLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 17 Entity 17 polymer

Description description	26S proteasome regulatory subunit 8 homolog
Molecular weight formula_weight	45342.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 18 Entity 18 polymer

Description description	26S proteasome regulatory subunit 6B homolog
Molecular weight formula_weight	47953.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEELGIVTPVEKAVEEKPAVKSYASLLAQLNGTVNNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 19 Entity 19 polymer

Description description	26S proteasome subunit RPT4
Molecular weight formula_weight	49480.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSEEQDPLLAGLGETSGDNHTQQSHEQQPEQPQETEEHHEEEPSRVDPEQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 20 Entity 20 polymer

Description description	26S proteasome regulatory subunit 6A
Molecular weight formula_weight	48315.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 21 Entity 21 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	1789.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

KWDFAKDIKGYGTQK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 22 Entity 22 polymer

Description description	Ubiquitin carboxyl-terminal hydrolase RPN11
Molecular weight formula_weight	34442.3 kDa
EC 编号 ec_number	3.4.19.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 23 Entity 23 polymer

Description description	Model substrate polypeptide
Molecular weight formula_weight	4068.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

GGKHTFNNENVSARLGGASIAVQAPAQPPPYSHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21

Entity 24 Entity 24 polymer

Description description	Ubiquitin-60S ribosomal protein L40
Molecular weight formula_weight	14583.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli B

Entity 25 Entity 25 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 26 Entity 26 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.17 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	48335

Yeast 26S proteasome bound to ubiquitinated substrate (4D motor state)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit beta type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer