SAXSdb — 5v8w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrator complex subunit 9

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 11 × 1 （Q5TA45） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 11 × 1 （Q5TA45） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 11 × 1 （Q5TA45） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 11 × 1 （Q5TA45） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INT9_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–78； UniProt 582–658 Author chain C； PDBConstruct 2–78； UniProt 582–658 Author chain E； PDBConstruct 2–78； UniProt 582–658 Author chain G； PDBConstruct 2–78； UniProt 582–658

Integrator complex subunit 11

Homo sapiens

UniProt Q5TA45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 9 × 1 （Q9NV88） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 9 × 1 （Q9NV88） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 9 × 1 （Q9NV88） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Integrator complex subunit 9 × 1 （Q9NV88） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INT11_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–114； UniProt 491–600 Author chain D； PDBConstruct 5–114； UniProt 491–600 Author chain F； PDBConstruct 5–114； UniProt 491–600 Author chain H； PDBConstruct 5–114； UniProt 491–600

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5v8w
Deposition date deposition_date	2017-03-22
Structure title title	Crystal structure of human Integrator IntS9-IntS11 CTD complex
Keywords keywords	snRNA processing, integrator complex, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5v8w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5v8w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5v8w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.77 Å
Rg (electron density)	17.76 Å
Total Rg	18.70 Å
Atom count	1437
Residues	181
Excluded volume	25751 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5v8w__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5v8w__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5v8w__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5v8w__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Integrator complex subunit 9
Molecular weight formula_weight	9003.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	6055

MKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Integrator complex subunit 11
Molecular weight formula_weight	12673.4 kDa
EC 编号 ec_number	3.1.27.-
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

GSHMRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	419

▶

Unit-cell length a length_a	63.010 Å
Unit-cell length b length_b	67.780 Å
Unit-cell length c length_c	98.585 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.65 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	24.830 Å
R factor r_factor	0.1686
R_work r_work	0.1665
R_free r_free	0.2203

Crystal structure of human Integrator IntS9-IntS11 CTD complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrator complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Integrator complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5v8w__assembly_1__model_1

5v8w__assembly_1__model_1 | I(q)

5v8w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of human Integrator IntS9-IntS11 CTD complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrator complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Integrator complex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5v8w__assembly_1__model_1

5v8w__assembly_1__model_1 | I(q)

5v8w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (1)