SAXSdb — 6ch2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthesis protein FlhA

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Flagellar hook-associated protein 2,Flagellar protein FliT × 1 （P0A1N3,P16328） GLYCEROL × 1 water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Flagellar hook-associated protein 2,Flagellar protein FliT × 1 （P0A1N3,P16328） GLYCEROL × 1 water × 2	Consistent with protein count
3	Insufficient information	Heteromer	Protein 2	Flagellar hook-associated protein 2,Flagellar protein FliT × 1 （P0A1N3,P16328） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLHA_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–334； UniProt 360–692 Author chain B； PDBConstruct 2–334； UniProt 360–692 Author chain C； PDBConstruct 2–334； UniProt 360–692

Flagellar hook-associated protein 2,Flagellar protein FliT

Salmonella typhi

UniProt P0A1N3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Flagellar biosynthesis protein FlhA × 1 （P40729） GLYCEROL × 1 water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Flagellar biosynthesis protein FlhA × 1 （P40729） GLYCEROL × 1 water × 2	Consistent with protein count
3	Insufficient information	Heteromer	Protein 2	Flagellar biosynthesis protein FlhA × 1 （P40729） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIT_SALTI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 58–179； UniProt 1–122 Author chain E； PDBConstruct 58–179； UniProt 1–122 Author chain F； PDBConstruct 58–179； UniProt 1–122

Flagellar hook-associated protein 2,Flagellar protein FliT

Salmonella typhi

UniProt P16328

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Flagellar biosynthesis protein FlhA × 1 （P40729） GLYCEROL × 1 water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Flagellar biosynthesis protein FlhA × 1 （P40729） GLYCEROL × 1 water × 2	Consistent with protein count
3	Insufficient information	Heteromer	Protein 2	Flagellar biosynthesis protein FlhA × 1 （P40729） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLID_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 5–44； UniProt 428–467 Author chain E； PDBConstruct 5–44； UniProt 428–467 Author chain F； PDBConstruct 5–44； UniProt 428–467

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ch2
Deposition date deposition_date	2018-02-21
Structure title title	Crystal structure of the cytoplasmic domain of FlhA and FliT-FliD complex
Keywords keywords	flagellar, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ch2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ch2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ch2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.84 Å
Rg (electron density)	30.72 Å
Total Rg	31.11 Å
Atom count	3722
Residues	475
Excluded volume	66514 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ch2__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6ch2__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6ch2__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthesis protein FlhA
Molecular weight formula_weight	36740.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	11214

GEDSLGMEVGYRLIPMVDFQQDGELLGRIRSIRKKFAQDMGFLPPVVHIRDNMDLQPARYRILMKGVEIGSGDAYPGRWLAINPGTAAGTLPGEKTVDPAFGLDAIWIESALKEQAQIQGFTVVEASTVVATHLNHLIGQFSAELFGRQEAQQLLDRVSQEMPKLTEDLVPGVVTLTTLHKVLQNLLAEKVPIRDMRTILETLAEHAPLQSDPHELTAVVRVALGRAITQQWFPGNEEVQVIGLDTALERLLLQALQGGGGLEPGLADRLLAQTQEALSRQEMLGAPPVLLVNHALRPLLSRFLRRSLPQLVVLSNLELSDNRHIRMTATIGGK

Source Source

Source organism organism	Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar hook-associated protein 2,Flagellar protein FliT
Molecular weight formula_weight	19555.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

GAHMSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKSGGSGGSGSGGSGGMTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVPDAPGAS

Source Source

Source organism organism	Salmonella typhi
NCBI taxonomy ID ncbi_taxonomy_id	90370
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	41

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	6ch2A01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	60 — FHIPEP family, domain 1

Domain ID domain_id	6ch2B01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	60 — FHIPEP family, domain 1

Domain ID domain_id	6ch2C01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	60 — FHIPEP family, domain 1

▶

Unit-cell length a length_a	49.110 Å
Unit-cell length b length_b	77.590 Å
Unit-cell length c length_c	119.270 Å
Unit-cell angle α angle_alpha	86.88 °
Unit-cell angle β angle_beta	89.00 °
Unit-cell angle γ angle_gamma	84.27 °
Molecules per unit cell Z z_pdb	3

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	39.695 Å
R factor r_factor	0.2348
R_work r_work	0.2334
R_free r_free	0.2662

Crystal structure of the cytoplasmic domain of FlhA and FliT-FliD complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthesis protein FlhA

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-associated protein 2,Flagellar protein FliT

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-associated protein 2,Flagellar protein FliT

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ch2__assembly_1__model_1

6ch2__assembly_1__model_1 | I(q)

6ch2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)

Crystal structure of the cytoplasmic domain of FlhA and FliT-FliD complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthesis protein FlhA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-associated protein 2,Flagellar protein FliT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-associated protein 2,Flagellar protein FliT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ch2__assembly_1__model_1

6ch2__assembly_1__model_1 | I(q)

6ch2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)