SAXSdb — 9u7y

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-associated protein 2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Flagellar hook-associated protein 3 × 11 （P16326） Flagellar hook-associated protein 1 × 11 （P0A1J5） Flagellar hook protein FlgE × 33 （P0A1J1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLID_SALTY
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain AA； PDBConstruct 1–467； UniProt 1–467 Author chain AB； PDBConstruct 1–467； UniProt 1–467 Author chain AD； PDBConstruct 1–467； UniProt 1–467 Author chain AE； PDBConstruct 1–467； UniProt 1–467 Author chain AC； PDBConstruct 1–467； UniProt 1–467

Flagellar hook-associated protein 3

OrganismNot specified

UniProt P16326

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Flagellar hook-associated protein 2 × 4 （P16328） Flagellar hook-associated protein 2 × 1 （P16328） Flagellar hook-associated protein 1 × 11 （P0A1J5） Flagellar hook protein FlgE × 33 （P0A1J1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGL_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain BA； PDBConstruct 1–317； UniProt 1–317 Author chain BB； PDBConstruct 1–317； UniProt 1–317 Author chain BC； PDBConstruct 1–317； UniProt 1–317 Author chain BD； PDBConstruct 1–317； UniProt 1–317 Author chain BE； PDBConstruct 1–317； UniProt 1–317 Author chain BF； PDBConstruct 1–317； UniProt 1–317 Author chain BG； PDBConstruct 1–317； UniProt 1–317 Author chain BH； PDBConstruct 1–317； UniProt 1–317 Author chain BI； PDBConstruct 1–317； UniProt 1–317 Author chain BJ； PDBConstruct 1–317； UniProt 1–317 Author chain BK； PDBConstruct 1–317； UniProt 1–317

Flagellar hook-associated protein 1

OrganismNot specified

UniProt P0A1J5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Flagellar hook-associated protein 2 × 4 （P16328） Flagellar hook-associated protein 2 × 1 （P16328） Flagellar hook-associated protein 3 × 11 （P16326） Flagellar hook protein FlgE × 33 （P0A1J1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGK_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain CA； PDBConstruct 1–553； UniProt 1–553 Author chain CB； PDBConstruct 1–553； UniProt 1–553 Author chain CC； PDBConstruct 1–553； UniProt 1–553 Author chain CD； PDBConstruct 1–553； UniProt 1–553 Author chain CE； PDBConstruct 1–553； UniProt 1–553 Author chain CF； PDBConstruct 1–553； UniProt 1–553 Author chain CG； PDBConstruct 1–553； UniProt 1–553 Author chain CH； PDBConstruct 1–553； UniProt 1–553 Author chain CI； PDBConstruct 1–553； UniProt 1–553 Author chain CJ； PDBConstruct 1–553； UniProt 1–553 Author chain CK； PDBConstruct 1–553； UniProt 1–553

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	Flagellar hook-associated protein 2 × 4 （P16328） Flagellar hook-associated protein 2 × 1 （P16328） Flagellar hook-associated protein 3 × 11 （P16326） Flagellar hook-associated protein 1 × 11 （P0A1J5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain DA； PDBConstruct 1–403； UniProt 1–403 Author chain DB； PDBConstruct 1–403； UniProt 1–403 Author chain DC； PDBConstruct 1–403； UniProt 1–403 Author chain DD； PDBConstruct 1–403； UniProt 1–403 Author chain DE； PDBConstruct 1–403； UniProt 1–403 Author chain DF； PDBConstruct 1–403； UniProt 1–403 Author chain DG； PDBConstruct 1–403； UniProt 1–403 Author chain DH； PDBConstruct 1–403； UniProt 1–403 Author chain DI； PDBConstruct 1–403； UniProt 1–403 Author chain DJ； PDBConstruct 1–403； UniProt 1–403 Author chain DK； PDBConstruct 1–403； UniProt 1–403 Author chain EA； PDBConstruct 1–403； UniProt 1–403 Author chain EB； PDBConstruct 1–403； UniProt 1–403 Author chain EC； PDBConstruct 1–403； UniProt 1–403 Author chain ED； PDBConstruct 1–403； UniProt 1–403 Author chain EE； PDBConstruct 1–403； UniProt 1–403 Author chain EF； PDBConstruct 1–403； UniProt 1–403 Author chain EG； PDBConstruct 1–403； UniProt 1–403 Author chain EH； PDBConstruct 1–403； UniProt 1–403 Author chain EI； PDBConstruct 1–403； UniProt 1–403 Author chain EJ； PDBConstruct 1–403； UniProt 1–403 Author chain EK； PDBConstruct 1–403； UniProt 1–403 Author chain FA； PDBConstruct 1–403； UniProt 1–403 Author chain FB； PDBConstruct 1–403； UniProt 1–403 Author chain FC； PDBConstruct 1–403； UniProt 1–403 Author chain FD； PDBConstruct 1–403； UniProt 1–403 Author chain FE； PDBConstruct 1–403； UniProt 1–403 Author chain FF； PDBConstruct 1–403； UniProt 1–403 Author chain FG； PDBConstruct 1–403； UniProt 1–403 Author chain FH； PDBConstruct 1–403； UniProt 1–403 Author chain FI； PDBConstruct 1–403； UniProt 1–403 Author chain FJ； PDBConstruct 1–403； UniProt 1–403 Author chain FK； PDBConstruct 1–403； UniProt 1–403

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9u7y
Deposition date deposition_date	2025-03-25
Structure title title	Structure of the tip region of the intial complex in bacterial flagellar filament assembly at 3.68 angstroms resolution, conformation 3.
Keywords keywords	flagellum, filament assembly, intial complex, fibril, PROTEIN FIBRIL; PROTEIN FIBRIL
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9u7y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9u7y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9u7y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	101.30 Å
Total Rg	101.40 Å
Atom count	181886
Residues	24480
Excluded volume	3189500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9u7y__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Flagellar hook-associated protein 2
Molecular weight formula_weight	49887.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AD,AE
Atom count atom_count	181886

MASISSLGVGSNLPLDQLLTDLTKNEKGRLTPITKQQSANSAKLTAYGTLKSALEKFQTANTALNKADLFKSTVASSTTEDLKVSTTAGAAAGTYKINVTQLAAAQSLATKTTFATTKEQLGDTSVTSRTIKIEQPGRKEPLEIKLDKGDTSMEAIRDAINDADSGIAASIVKVKENEFQLVLTANSGTDNTMKITVEGDTKLNDLLAYDSTTNTGNMQELVKAENAKLNVNGIDIERQSNTVTDAPQGITLTLTKKVTDATVTVTKDDTKAKEAIKSWVDAYNSLVDTFSSLTKYTAVEPGEEASDKNGALLGDSVVRTIQTGIRAQFANSGSNSAFKTMAEIGITQDGTSGKLKIDDDKLTKVLKDNTAAARELLVGDGKETGITTKIATEVKSYLADDGIIDNAQDNVNATLKSLTKQYLSVSNSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKS

Entity 2 Entity 2 polymer

Description description	Flagellar hook-associated protein 2
Molecular weight formula_weight	49871.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MASISSLGVGSNLPLDQLLTDLTKNEKGRLTPITKQQSANSAKLTAFGTLKSALEKFQTANTALNKADLFKSTVASSTTEDLKVSTTAGAAAGTYKINVTQLAAAQSLATKTTFATTKEQLGDTSVTSRTIKIEQPGRKEPLEIKLDKGDTSMEAIRDAINDADSGIAASIVKVKENEFQLVLTANSGTDNTMKITVEGDTKLNDLLAYDSTTNTGNMQELVKAENAKLNVNGIDIERQSNTVTDAPQGITLTLTKKVTDATVTVTKDDTKAKEAIKSWVDAYNSLVDTFSSLTKYTAVEPGEEASDKNGALLGDSVVRTIQTGIRAQFANSGSNSAFKTMAEIGITQDGTSGKLKIDDDKLTKVLKDNTAAARELLVGDGKETGITTKIATEVKSYLADDGIIDNAQDNVNATLKSLTKQYLSVSNSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKS

Entity 3 Entity 3 polymer

Description description	Flagellar hook-associated protein 3
Molecular weight formula_weight	34202.0 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB,BC,BD,BE,BF,BG,BH,BI,BJ,BK

MRISTQMMYEQNMSGITNSQAEWMKLGEQMSTGKRVTNPSDDPIAASQAVVLSQAQAQNSQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIRDQLMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVIGHTGAQIFNSITSNAVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNNVEKEKAAAAIDKTNRGLKNSLNNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNLVDVDWNSVISSYVMQQAALQASYKTFTDMQGMSLFQLNR

Entity 4 Entity 4 polymer

Description description	Flagellar hook-associated protein 1
Molecular weight formula_weight	59153.8 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CA,CB,CC,CD,CE,CF,CG,CH,CI,CJ,CK

MSSLINHAMSGLNAAQAALNTVSNNINNYNVAGYTRQTTILAQANSTLGAGGWIGNGVYVSGVQREYDAFITNQLRGAQNQSSGLTTRYEQMSKIDNLLADKSSSLSGSLQSFFTSLQTLVSNAEDPAARQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMANGYTLVQGSTARQLAAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLLTFRSQDLDQTRNTLGQLALAFADAFNAQHTKGYDADGNKGKDFFSIGSPVVYSNSNNADKTVSLTAKVVDSTKVQATDYKIVFDGTDWQVTRTADNTTFTATKDADGKLEIDGLKVTVGTGAQKNDSFLLKPVSNAIVDMNVKVTNEAEIAMASESKLDPDVDTGDSDNRNGQALLDLQNSNVVGGNKTFNDAYATLVSDVGNKTSTLKTSSTTQANVVKQLYKQQQSVSGVNLDEEYGNLQRYQQYYLANAQVLQTANALFDALLNIR

Entity 5 Entity 5 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	33

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DA,DB,DC,DD,DE,DF,DG,DH,DI,DJ,DK,EA,EB,EC,ED,EE,EF,EG,EH,EI,EJ,EK,FA,FB,FC,FD,FE,FF,FG,FH,FI,FJ,FK

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.68 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	254124

Structure of the tip region of the intial complex in bacterial flagellar filament assembly at 3.68 angstroms resolution, conformation 3.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-associated protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9u7y__assembly_1__model_1

9u7y__assembly_1__model_1 | I(q)

9u7y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

Structure of the tip region of the intial complex in bacterial flagellar filament assembly at 3.68 angstroms resolution, conformation 3.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-associated protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9u7y__assembly_1__model_1

9u7y__assembly_1__model_1 | I(q)

9u7y__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)