SAXSdb — 9u7y

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-associated protein 2

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 60 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain AA； UniProt 1–467 Chain AB； UniProt 1–467 Chain AC； UniProt 1–467 Chain AD； UniProt 1–467 Chain AE； UniProt 1–467	Not recorded	Flagellar hook-associated protein 3 × 11 （P16326） Flagellar hook-associated protein 1 × 11 （P0A1J5） Flagellar hook protein FlgE × 33 （P0A1J1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.68 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9U7Y	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GNA Crystal Structure of flagellin assembly related protein Deposited 2016-07-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 401–467（67 aa） Fragment：UNP RESIDUES 401-467	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；296 K；5% PEG 400, 10% isopropanol, 0.2 M magnesium chloride, 0.1 M Tris-HCl pH 8.0	Resolution 2.30 Å R-free 0.229
5KRW Recognition and targeting mechanisms by chaperones in flagella assembly and operation Deposited 2016-07-07	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 428–467（40 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；305 K；Ionic strength (raw mmCIF value) 120；Pressure 1 NMR sample composition 1 mM [U-99% 13C; U-99% 15N; U-99% 2H] FliT-FliD_fusion, 20 mM potassium phosphate, 100 mM potassium chloride, 0.5 mM EDTA, 5 mM beta-mercaptoethanol, 0.05 % sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM U[15N,2H] 1H-13C-ILVMAT-methyl FliT-FliD_fusion, 20 mM potassium phosphate, 100 mM potassium chloride, 0.5 mM EDTA, 5 mM beta-mercaptoethanol, 0.05 % sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-99% 13C; U-99% 15N] FliT-FliD_fusion, 20 mM potassium phosphate, 100 mM potassium chloride, 0.5 mM EDTA, 5 mM beta-mercaptoethanol, 0.05 % sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6CH2 Crystal structure of the cytoplasmic domain of FlhA and FliT-FliD complex Deposited 2018-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 428–467（40 aa） Fragment：unp residues 1-122; 428-467	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；CaCl2, PEG8000, Sodium cacodylate	Resolution 2.70 Å R-free 0.266
6CH2 Crystal structure of the cytoplasmic domain of FlhA and FliT-FliD complex Deposited 2018-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 428–467（40 aa） Fragment：unp residues 1-122; 428-467	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；CaCl2, PEG8000, Sodium cacodylate	Resolution 2.70 Å R-free 0.266
6CH2 Crystal structure of the cytoplasmic domain of FlhA and FliT-FliD complex Deposited 2018-02-21	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 428–467（40 aa） Fragment：unp residues 1-122; 428-467	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；CaCl2, PEG8000, Sodium cacodylate	Resolution 2.70 Å R-free 0.266
9M67 the flagellar filament cap FliD in complex with FliC Deposited 2025-03-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 10 PDB declaration: decameric	Chain A 1–467（467 aa） Chain B 1–467（467 aa） Chain C 1–467（467 aa） Chain D 1–467（467 aa） Chain E 1–467（467 aa） Chain F 1–467（467 aa） Chain G 1–467（467 aa） Chain H 1–467（467 aa） Chain I 1–467（467 aa） Chain J 1–467（467 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9M68 the flagellar filament cap FliD in complex with FlgL Deposited 2025-03-07	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 19–433（415 aa） Chain B 19–433（415 aa） Chain D 19–433（415 aa） Chain G 19–433（415 aa） Chain I 19–433（415 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9M6H structure of FliD-FliC at a 10:10 stoichiometry Deposited 2025-03-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: 20-meric	Chain A 21–450（430 aa） Chain C 21–450（430 aa） Chain E 21–450（430 aa） Chain G 21–450（430 aa） Chain I 21–450（430 aa） Chain K 21–450（430 aa） Chain M 21–450（430 aa） Chain O 21–450（430 aa） Chain Q 21–450（430 aa） Chain S 21–450（430 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å
9M6I structure of the FliD cap Deposited 2025-03-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–467（467 aa） Chain B 1–467（467 aa） Chain C 1–467（467 aa） Chain D 1–467（467 aa） Chain E 1–467（467 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.06 Å
9U4R Structure of the intial complex in filament assembly at 3.23 angstroms resolution, conformation 2. Deposited 2025-03-20	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 73 PDB declaration: 73-meric	Chain AA 1–467（467 aa） Chain AB 1–467（467 aa） Chain AC 1–467（467 aa） Chain AD 1–467（467 aa） Chain AE 1–467（467 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å

8 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLID_SALTY
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain AA； PDBConstruct 1–467； UniProt 1–467 Author chain AB； PDBConstruct 1–467； UniProt 1–467 Author chain AD； PDBConstruct 1–467； UniProt 1–467 Author chain AE； PDBConstruct 1–467； UniProt 1–467 Author chain AC； PDBConstruct 1–467； UniProt 1–467

Flagellar hook-associated protein 3

OrganismNot specified

UniProt P16326

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 60 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain BA； UniProt 1–317 Chain BB； UniProt 1–317 Chain BC； UniProt 1–317 Chain BD； UniProt 1–317 Chain BE； UniProt 1–317 Chain BF； UniProt 1–317 Chain BG； UniProt 1–317 Chain BH； UniProt 1–317 Chain BI； UniProt 1–317 Chain BJ； UniProt 1–317 Chain BK； UniProt 1–317	Not recorded	Flagellar hook-associated protein 2 × 4 （P16328） Flagellar hook-associated protein 2 × 1 （P16328） Flagellar hook-associated protein 1 × 11 （P0A1J5） Flagellar hook protein FlgE × 33 （P0A1J1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.68 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9U7Y	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2D4X Crystal structure of a 26K fragment of HAP3 (FlgL) Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–286（247 aa） Fragment：FL26	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.2；277 K；10-20% PEG 8000, 0.2M magnesium chloride, 0.1M Phosphate-citrate, pH 4.2, VAPOR DIFFUSION, temperature 277K	Resolution 1.90 Å R-free 0.258
9M68 the flagellar filament cap FliD in complex with FlgL Deposited 2025-03-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 51–273（223 aa） Chain E 51–273（223 aa） Chain F 51–273（223 aa） Chain H 51–273（223 aa） Chain J 51–273（223 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9U4R Structure of the intial complex in filament assembly at 3.23 angstroms resolution, conformation 2. Deposited 2025-03-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 73 PDB declaration: 73-meric	Chain BA 1–317（317 aa） Chain BB 1–317（317 aa） Chain BC 1–317（317 aa） Chain BD 1–317（317 aa） Chain BE 1–317（317 aa） Chain BG 1–317（317 aa） Chain BH 1–317（317 aa） Chain BI 1–317（317 aa） Chain BJ 1–317（317 aa） Chain BK 1–317（317 aa） Chain BL 1–317（317 aa） Chain BM 1–317（317 aa） Chain BN 1–317（317 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGL_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain BA； PDBConstruct 1–317； UniProt 1–317 Author chain BB； PDBConstruct 1–317； UniProt 1–317 Author chain BC； PDBConstruct 1–317； UniProt 1–317 Author chain BD； PDBConstruct 1–317； UniProt 1–317 Author chain BE； PDBConstruct 1–317； UniProt 1–317 Author chain BF； PDBConstruct 1–317； UniProt 1–317 Author chain BG； PDBConstruct 1–317； UniProt 1–317 Author chain BH； PDBConstruct 1–317； UniProt 1–317 Author chain BI； PDBConstruct 1–317； UniProt 1–317 Author chain BJ； PDBConstruct 1–317； UniProt 1–317 Author chain BK； PDBConstruct 1–317； UniProt 1–317

Flagellar hook-associated protein 1

OrganismNot specified

UniProt P0A1J5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 60 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain CA； UniProt 1–553 Chain CB； UniProt 1–553 Chain CC； UniProt 1–553 Chain CD； UniProt 1–553 Chain CE； UniProt 1–553 Chain CF； UniProt 1–553 Chain CG； UniProt 1–553 Chain CH； UniProt 1–553 Chain CI； UniProt 1–553 Chain CJ； UniProt 1–553 Chain CK； UniProt 1–553	Not recorded	Flagellar hook-associated protein 2 × 4 （P16328） Flagellar hook-associated protein 2 × 1 （P16328） Flagellar hook-associated protein 3 × 11 （P16326） Flagellar hook protein FlgE × 33 （P0A1J1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.68 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9U7Y	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2D4Y Crystal structure of a 49K fragment of HAP1 (FlgK) Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 65–526（462 aa） Fragment：FK49	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；289 K；14-15% PEG 8000, 20-25% isopropanol, 0.1M citrate, pH 5.5, VAPOR DIFFUSION, temperature 289K	Resolution 2.10 Å R-free 0.255
2D4Y Crystal structure of a 49K fragment of HAP1 (FlgK) Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 65–526（462 aa） Fragment：FK49	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；289 K；14-15% PEG 8000, 20-25% isopropanol, 0.1M citrate, pH 5.5, VAPOR DIFFUSION, temperature 289K	Resolution 2.10 Å R-free 0.255
9U4R Structure of the intial complex in filament assembly at 3.23 angstroms resolution, conformation 2. Deposited 2025-03-20	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 73 PDB declaration: 73-meric	Chain CA 1–553（553 aa） Chain CB 1–553（553 aa） Chain CC 1–553（553 aa） Chain CD 1–553（553 aa） Chain CE 1–553（553 aa） Chain CF 1–553（553 aa） Chain CG 1–553（553 aa） Chain CH 1–553（553 aa） Chain CI 1–553（553 aa） Chain CJ 1–553（553 aa） Chain CK 1–553（553 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å

2 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGK_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain CA； PDBConstruct 1–553； UniProt 1–553 Author chain CB； PDBConstruct 1–553； UniProt 1–553 Author chain CC； PDBConstruct 1–553； UniProt 1–553 Author chain CD； PDBConstruct 1–553； UniProt 1–553 Author chain CE； PDBConstruct 1–553； UniProt 1–553 Author chain CF； PDBConstruct 1–553； UniProt 1–553 Author chain CG； PDBConstruct 1–553； UniProt 1–553 Author chain CH； PDBConstruct 1–553； UniProt 1–553 Author chain CI； PDBConstruct 1–553； UniProt 1–553 Author chain CJ； PDBConstruct 1–553； UniProt 1–553 Author chain CK； PDBConstruct 1–553； UniProt 1–553

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 60 PDB declaration: 60-meric（60） Consistent with protein copy count	Chain DA； UniProt 1–403 Chain DB； UniProt 1–403 Chain DC； UniProt 1–403 Chain DD； UniProt 1–403 Chain DE； UniProt 1–403 Chain DF； UniProt 1–403 Chain DG； UniProt 1–403 Chain DH； UniProt 1–403 Chain DI； UniProt 1–403 Chain DJ； UniProt 1–403 Chain DK； UniProt 1–403 Chain EA； UniProt 1–403 Chain EB； UniProt 1–403 Chain EC； UniProt 1–403 Chain ED； UniProt 1–403 Chain EE； UniProt 1–403 Chain EF； UniProt 1–403 Chain EG； UniProt 1–403 Chain EH； UniProt 1–403 Chain EI； UniProt 1–403 Chain EJ； UniProt 1–403 Chain EK； UniProt 1–403 Chain FA； UniProt 1–403 Chain FB； UniProt 1–403 Chain FC； UniProt 1–403 Chain FD； UniProt 1–403 Chain FE； UniProt 1–403 Chain FF； UniProt 1–403 Chain FG； UniProt 1–403 Chain FH； UniProt 1–403 Chain FI； UniProt 1–403 Chain FJ； UniProt 1–403 Chain FK； UniProt 1–403	Not recorded	Flagellar hook-associated protein 2 × 4 （P16328） Flagellar hook-associated protein 2 × 1 （P16328） Flagellar hook-associated protein 3 × 11 （P16326） Flagellar hook-associated protein 1 × 11 （P0A1J5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.68 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9U7Y	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1WLG Crystal structure of FlgE31, a major fragment of the hook protein Deposited 2004-06-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 71–369（299 aa） Fragment：FlgE31 Chain B 71–369（299 aa） Fragment：FlgE31	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；289 K；PEG 2000, copper acetate, cacodylate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 1.80 Å R-free 0.242
3A69 Atomic model of the bacterial flagellar hook based on docking an X-ray derived structure and terminal two alpha-helices into an 7.1 angstrom resolution cryoEM map Deposited 2009-08-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 11 PDB declaration: helical	Chain A 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris-HCl, 100mM NaCl；pH 7；20mM Tris-HCl, 100mM NaCl cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.10 Å
3A69 Atomic model of the bacterial flagellar hook based on docking an X-ray derived structure and terminal two alpha-helices into an 7.1 angstrom resolution cryoEM map Deposited 2009-08-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris-HCl, 100mM NaCl；pH 7；20mM Tris-HCl, 100mM NaCl cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.10 Å
3A69 Atomic model of the bacterial flagellar hook based on docking an X-ray derived structure and terminal two alpha-helices into an 7.1 angstrom resolution cryoEM map Deposited 2009-08-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris-HCl, 100mM NaCl；pH 7；20mM Tris-HCl, 100mM NaCl cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.10 Å
6K3I Salmonella hook in curved state - 66 subunit models Deposited 2019-05-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 66 PDB declaration: 66-meric	Chain AA 2–403（402 aa） Chain AB 2–403（402 aa） Chain AC 2–403（402 aa） Chain AD 2–403（402 aa） Chain AE 2–403（402 aa） Chain AF 2–403（402 aa） Chain AG 2–403（402 aa） Chain AH 2–403（402 aa） Chain AI 2–403（402 aa） Chain AJ 2–403（402 aa） Chain AK 2–403（402 aa） Chain BA 2–403（402 aa） Chain BB 2–403（402 aa） Chain BC 2–403（402 aa） Chain BD 2–403（402 aa） Chain BE 2–403（402 aa） Chain BF 2–403（402 aa） Chain BG 2–403（402 aa） Chain BH 2–403（402 aa） Chain BI 2–403（402 aa） Chain BJ 2–403（402 aa） Chain BK 2–403（402 aa） Chain CA 2–403（402 aa） Chain CB 2–403（402 aa） Chain CC 2–403（402 aa） Chain CD 2–403（402 aa） Chain CE 2–403（402 aa） Chain CF 2–403（402 aa） Chain CG 2–403（402 aa） Chain CH 2–403（402 aa） Chain CI 2–403（402 aa） Chain CJ 2–403（402 aa） Chain CK 2–403（402 aa） Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 3.5 cryo-EM vitrification conditions Cryogen ETHANE；3 second blot, 4.0uL	Resolution 2.86 Å
7CBM Cryo-EM structure of the flagellar distal rod with partial hook from Salmonella Deposited 2020-06-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGB Cryo-EM structure of the flagellar hook from Salmonella Deposited 2020-07-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain DL 1–403（403 aa） Chain DM 1–403（403 aa） Chain DN 1–403（403 aa） Chain DO 1–403（403 aa） Chain DP 1–403（403 aa） Chain DQ 1–403（403 aa） Chain DR 1–403（403 aa） Chain DS 1–403（403 aa） Chain DT 1–403（403 aa） Chain DU 1–403（403 aa） Chain DV 1–403（403 aa） Chain DW 1–403（403 aa） Chain DX 1–403（403 aa） Chain DY 1–403（403 aa） Chain DZ 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.40 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa） Chain DL 1–403（403 aa） Chain DM 1–403（403 aa） Chain DN 1–403（403 aa） Chain DO 1–403（403 aa） Chain DP 1–403（403 aa） Chain DQ 1–403（403 aa） Chain DR 1–403（403 aa） Chain DS 1–403（403 aa） Chain DT 1–403（403 aa） Chain DU 1–403（403 aa） Chain DV 1–403（403 aa） Chain DW 1–403（403 aa） Chain DX 1–403（403 aa） Chain DY 1–403（403 aa） Chain DZ 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WKI Cryo-EM structure of the distal rod-hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLP Cryo-EM structure of the distal rod-hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9M7B Structure of flagellar hook at 3.14 angstroms resolution,conformation 2. Deposited 2025-03-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 66 PDB declaration: 66-meric	Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa） Chain GA 2–403（402 aa） Chain GB 2–403（402 aa） Chain GC 2–403（402 aa） Chain GD 2–403（402 aa） Chain GE 2–403（402 aa） Chain GF 2–403（402 aa） Chain GG 2–403（402 aa） Chain GH 2–403（402 aa） Chain GI 2–403（402 aa） Chain GJ 2–403（402 aa） Chain GK 2–403（402 aa） Chain HA 2–403（402 aa） Chain HB 2–403（402 aa） Chain HC 2–403（402 aa） Chain HD 2–403（402 aa） Chain HE 2–403（402 aa） Chain HF 2–403（402 aa） Chain HG 2–403（402 aa） Chain HH 2–403（402 aa） Chain HI 2–403（402 aa） Chain HJ 2–403（402 aa） Chain HK 2–403（402 aa） Chain IA 2–403（402 aa） Chain IB 2–403（402 aa） Chain IC 2–403（402 aa） Chain ID 2–403（402 aa） Chain IE 2–403（402 aa） Chain IF 2–403（402 aa） Chain IG 2–403（402 aa） Chain IH 2–403（402 aa） Chain II 2–403（402 aa） Chain IJ 2–403（402 aa） Chain IK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å
9M7Q Structure of flagellar hook at 3.18 angstroms resolution,conformation 1. Deposited 2025-03-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 44 PDB declaration: 44-meric	Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa） Chain GA 2–403（402 aa） Chain GB 2–403（402 aa） Chain GC 2–403（402 aa） Chain GD 2–403（402 aa） Chain GE 2–403（402 aa） Chain GF 2–403（402 aa） Chain GG 2–403（402 aa） Chain GH 2–403（402 aa） Chain GI 2–403（402 aa） Chain GJ 2–403（402 aa） Chain GK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9M9F Structure of flagellar hook at 3.50 angstroms resolution,conformation 3. Deposited 2025-03-13	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 44 PDB declaration: 44-meric	Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa） Chain GA 2–403（402 aa） Chain GB 2–403（402 aa） Chain GC 2–403（402 aa） Chain GD 2–403（402 aa） Chain GE 2–403（402 aa） Chain GF 2–403（402 aa） Chain GG 2–403（402 aa） Chain GH 2–403（402 aa） Chain GI 2–403（402 aa） Chain GJ 2–403（402 aa） Chain GK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9U4R Structure of the intial complex in filament assembly at 3.23 angstroms resolution, conformation 2. Deposited 2025-03-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 73 PDB declaration: 73-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa） Chain EH 1–403（403 aa） Chain EI 1–403（403 aa） Chain EJ 1–403（403 aa） Chain EK 1–403（403 aa） Chain FA 1–403（403 aa） Chain FB 1–403（403 aa） Chain FC 1–403（403 aa） Chain FD 1–403（403 aa） Chain FE 1–403（403 aa） Chain FF 1–403（403 aa） Chain FG 1–403（403 aa） Chain FH 1–403（403 aa） Chain FI 1–403（403 aa） Chain FJ 1–403（403 aa） Chain FK 1–403（403 aa） Chain GA 1–403（403 aa） Chain GB 1–403（403 aa） Chain GC 1–403（403 aa） Chain GD 1–403（403 aa） Chain GE 1–403（403 aa） Chain GF 1–403（403 aa） Chain GG 1–403（403 aa） Chain GH 1–403（403 aa） Chain GI 1–403（403 aa） Chain GJ 1–403（403 aa） Chain GK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å

20 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain DA； PDBConstruct 1–403； UniProt 1–403 Author chain DB； PDBConstruct 1–403； UniProt 1–403 Author chain DC； PDBConstruct 1–403； UniProt 1–403 Author chain DD； PDBConstruct 1–403； UniProt 1–403 Author chain DE； PDBConstruct 1–403； UniProt 1–403 Author chain DF； PDBConstruct 1–403； UniProt 1–403 Author chain DG； PDBConstruct 1–403； UniProt 1–403 Author chain DH； PDBConstruct 1–403； UniProt 1–403 Author chain DI； PDBConstruct 1–403； UniProt 1–403 Author chain DJ； PDBConstruct 1–403； UniProt 1–403 Author chain DK； PDBConstruct 1–403； UniProt 1–403 Author chain EA； PDBConstruct 1–403； UniProt 1–403 Author chain EB； PDBConstruct 1–403； UniProt 1–403 Author chain EC； PDBConstruct 1–403； UniProt 1–403 Author chain ED； PDBConstruct 1–403； UniProt 1–403 Author chain EE； PDBConstruct 1–403； UniProt 1–403 Author chain EF； PDBConstruct 1–403； UniProt 1–403 Author chain EG； PDBConstruct 1–403； UniProt 1–403 Author chain EH； PDBConstruct 1–403； UniProt 1–403 Author chain EI； PDBConstruct 1–403； UniProt 1–403 Author chain EJ； PDBConstruct 1–403； UniProt 1–403 Author chain EK； PDBConstruct 1–403； UniProt 1–403 Author chain FA； PDBConstruct 1–403； UniProt 1–403 Author chain FB； PDBConstruct 1–403； UniProt 1–403 Author chain FC； PDBConstruct 1–403； UniProt 1–403 Author chain FD； PDBConstruct 1–403； UniProt 1–403 Author chain FE； PDBConstruct 1–403； UniProt 1–403 Author chain FF； PDBConstruct 1–403； UniProt 1–403 Author chain FG； PDBConstruct 1–403； UniProt 1–403 Author chain FH； PDBConstruct 1–403； UniProt 1–403 Author chain FI； PDBConstruct 1–403； UniProt 1–403 Author chain FJ； PDBConstruct 1–403； UniProt 1–403 Author chain FK； PDBConstruct 1–403； UniProt 1–403

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9u7y
Deposition date deposition_date	2025-03-25
Structure title title	Structure of the tip region of the intial complex in bacterial flagellar filament assembly at 3.68 angstroms resolution, conformation 3.
Keywords keywords	flagellum, filament assembly, intial complex, fibril, PROTEIN FIBRIL; PROTEIN FIBRIL
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	101.30 Å
Forward intensity I(0) i0	100591000000.00
Molecular weight molecular_weight	2588200.0 kDa
Excluded volume excluded_volume	3189500 Å³
Envelope volume envelope_volume	5358900 Å³
Hydration-shell volume shell_volume	422930 Å³
Envelope diameter envelope_diameter	374.1 Å
Shell Rg shell_rg	106.90 Å
Envelope Rg envelope_rg	101.60 Å
Shape Rg shape_rg	101.30 Å
Total Rg total_rg	101.40 Å
Total atoms total_atoms	181886
Residues n_residues	24480
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	293.9 Å
Rg (real space) rg_real	96.43 Å
Rg uncertainty (real space) rg_real_error	1.09 Å
I(0) (real space) i0_real	9.6610e+10
I(0) uncertainty (real space) i0_real_error	2.0910e+09
Rg (reciprocal space) rg_reciprocal	97.83 Å
I(0) (reciprocal space) i0_reciprocal	99700000000.0000
Solution quality estimate total_estimate	0.8910
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	117.6 Å
Skewness Skewness skewness	0.477
Kurtosis Kurtosis kurtosis	-0.137
Angular range angular_range	— – 0.0750 Å⁻¹
Current regularization parameter α current_alpha	0.6480
Highest regularization parameter α highest_alpha	28630000000.0000
Real-space data points n_real_points	16
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.899; Stabil: 0.978; Sysdev: 1.000; Positv: 1.000; Valcen: 0.920; Smooth: 0.034

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Flagellar hook-associated protein 2
Molecular weight formula_weight	49887.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AD,AE
Atom count atom_count	181886

MASISSLGVGSNLPLDQLLTDLTKNEKGRLTPITKQQSANSAKLTAYGTLKSALEKFQTANTALNKADLFKSTVASSTTEDLKVSTTAGAAAGTYKINVTQLAAAQSLATKTTFATTKEQLGDTSVTSRTIKIEQPGRKEPLEIKLDKGDTSMEAIRDAINDADSGIAASIVKVKENEFQLVLTANSGTDNTMKITVEGDTKLNDLLAYDSTTNTGNMQELVKAENAKLNVNGIDIERQSNTVTDAPQGITLTLTKKVTDATVTVTKDDTKAKEAIKSWVDAYNSLVDTFSSLTKYTAVEPGEEASDKNGALLGDSVVRTIQTGIRAQFANSGSNSAFKTMAEIGITQDGTSGKLKIDDDKLTKVLKDNTAAARELLVGDGKETGITTKIATEVKSYLADDGIIDNAQDNVNATLKSLTKQYLSVSNSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKS

Entity 2 Entity 2 polymer

Description description	Flagellar hook-associated protein 2
Molecular weight formula_weight	49871.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MASISSLGVGSNLPLDQLLTDLTKNEKGRLTPITKQQSANSAKLTAFGTLKSALEKFQTANTALNKADLFKSTVASSTTEDLKVSTTAGAAAGTYKINVTQLAAAQSLATKTTFATTKEQLGDTSVTSRTIKIEQPGRKEPLEIKLDKGDTSMEAIRDAINDADSGIAASIVKVKENEFQLVLTANSGTDNTMKITVEGDTKLNDLLAYDSTTNTGNMQELVKAENAKLNVNGIDIERQSNTVTDAPQGITLTLTKKVTDATVTVTKDDTKAKEAIKSWVDAYNSLVDTFSSLTKYTAVEPGEEASDKNGALLGDSVVRTIQTGIRAQFANSGSNSAFKTMAEIGITQDGTSGKLKIDDDKLTKVLKDNTAAARELLVGDGKETGITTKIATEVKSYLADDGIIDNAQDNVNATLKSLTKQYLSVSNSIDETVARYKAQFTQLDTMMSKLNNTSSYLTQQFTAMNKS

Entity 3 Entity 3 polymer

Description description	Flagellar hook-associated protein 3
Molecular weight formula_weight	34202.0 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB,BC,BD,BE,BF,BG,BH,BI,BJ,BK

MRISTQMMYEQNMSGITNSQAEWMKLGEQMSTGKRVTNPSDDPIAASQAVVLSQAQAQNSQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIRDQLMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVIGHTGAQIFNSITSNAVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNNVEKEKAAAAIDKTNRGLKNSLNNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNLVDVDWNSVISSYVMQQAALQASYKTFTDMQGMSLFQLNR

Entity 4 Entity 4 polymer

Description description	Flagellar hook-associated protein 1
Molecular weight formula_weight	59153.8 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CA,CB,CC,CD,CE,CF,CG,CH,CI,CJ,CK

MSSLINHAMSGLNAAQAALNTVSNNINNYNVAGYTRQTTILAQANSTLGAGGWIGNGVYVSGVQREYDAFITNQLRGAQNQSSGLTTRYEQMSKIDNLLADKSSSLSGSLQSFFTSLQTLVSNAEDPAARQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMANGYTLVQGSTARQLAAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLLTFRSQDLDQTRNTLGQLALAFADAFNAQHTKGYDADGNKGKDFFSIGSPVVYSNSNNADKTVSLTAKVVDSTKVQATDYKIVFDGTDWQVTRTADNTTFTATKDADGKLEIDGLKVTVGTGAQKNDSFLLKPVSNAIVDMNVKVTNEAEIAMASESKLDPDVDTGDSDNRNGQALLDLQNSNVVGGNKTFNDAYATLVSDVGNKTSTLKTSSTTQANVVKQLYKQQQSVSGVNLDEEYGNLQRYQQYYLANAQVLQTANALFDALLNIR

Entity 5 Entity 5 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	33

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DA,DB,DC,DD,DE,DF,DG,DH,DI,DJ,DK,EA,EB,EC,ED,EE,EF,EG,EH,EI,EJ,EK,FA,FB,FC,FD,FE,FF,FG,FH,FI,FJ,FK

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.68 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	254124

fit	/app/data/saxs_computation/u7/9u7y/9u7y.fit
pddf	/app/data/pr_computation/u7/9u7y/9u7y.pr.out
profile	/app/data/saxs_computation/u7/9u7y/9u7y.dat

Structure of the tip region of the intial complex in bacterial flagellar filament assembly at 3.68 angstroms resolution, conformation 3.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-associated protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)