8wlq

Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGG_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–260； UniProt 1–260 Author chain 1； PDBConstruct 1–260； UniProt 1–260 Author chain 2； PDBConstruct 1–260； UniProt 1–260 Author chain 3； PDBConstruct 1–260； UniProt 1–260 Author chain 4； PDBConstruct 1–260； UniProt 1–260 Author chain 5； PDBConstruct 1–260； UniProt 1–260 Author chain 6； PDBConstruct 1–260； UniProt 1–260 Author chain 7； PDBConstruct 1–260； UniProt 1–260 Author chain 8； PDBConstruct 1–260； UniProt 1–260 Author chain 9； PDBConstruct 1–260； UniProt 1–260 Author chain ZA； PDBConstruct 1–260； UniProt 1–260 Author chain ZB； PDBConstruct 1–260； UniProt 1–260 Author chain ZC； PDBConstruct 1–260； UniProt 1–260 Author chain ZD； PDBConstruct 1–260； UniProt 1–260 Author chain ZE； PDBConstruct 1–260； UniProt 1–260 Author chain r； PDBConstruct 1–260； UniProt 1–260 Author chain s； PDBConstruct 1–260； UniProt 1–260 Author chain t； PDBConstruct 1–260； UniProt 1–260 Author chain u； PDBConstruct 1–260； UniProt 1–260 Author chain v； PDBConstruct 1–260； UniProt 1–260 Author chain w； PDBConstruct 1–260； UniProt 1–260 Author chain x； PDBConstruct 1–260； UniProt 1–260 Author chain y； PDBConstruct 1–260； UniProt 1–260 Author chain z； PDBConstruct 1–260； UniProt 1–260

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain ZF； PDBConstruct 1–403； UniProt 1–403 Author chain ZG； PDBConstruct 1–403； UniProt 1–403 Author chain ZH； PDBConstruct 1–403； UniProt 1–403 Author chain ZI； PDBConstruct 1–403； UniProt 1–403 Author chain ZJ； PDBConstruct 1–403； UniProt 1–403 Author chain ZK； PDBConstruct 1–403； UniProt 1–403 Author chain ZL； PDBConstruct 1–403； UniProt 1–403 Author chain ZM； PDBConstruct 1–403； UniProt 1–403 Author chain ZN； PDBConstruct 1–403； UniProt 1–403 Author chain ZO； PDBConstruct 1–403； UniProt 1–403 Author chain ZP； PDBConstruct 1–403； UniProt 1–403 Author chain ZQ； PDBConstruct 1–403； UniProt 1–403 Author chain ZR； PDBConstruct 1–403； UniProt 1–403 Author chain ZS； PDBConstruct 1–403； UniProt 1–403 Author chain ZT； PDBConstruct 1–403； UniProt 1–403 Author chain ZU； PDBConstruct 1–403； UniProt 1–403 Author chain ZV； PDBConstruct 1–403； UniProt 1–403 Author chain ZW； PDBConstruct 1–403； UniProt 1–403 Author chain ZX； PDBConstruct 1–403； UniProt 1–403 Author chain ZY； PDBConstruct 1–403； UniProt 1–403 Author chain ZZ； PDBConstruct 1–403； UniProt 1–403 Author chain Za； PDBConstruct 1–403； UniProt 1–403 Author chain Zb； PDBConstruct 1–403； UniProt 1–403 Author chain Zc； PDBConstruct 1–403； UniProt 1–403 Author chain Zd； PDBConstruct 1–403； UniProt 1–403 Author chain Ze； PDBConstruct 1–403； UniProt 1–403 Author chain Zf； PDBConstruct 1–403； UniProt 1–403 Author chain Zg； PDBConstruct 1–403； UniProt 1–403 Author chain Zh； PDBConstruct 1–403； UniProt 1–403

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–89； UniProt 1–89 Author chain B； PDBConstruct 1–89； UniProt 1–89 Author chain C； PDBConstruct 1–89； UniProt 1–89 Author chain D； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–245； UniProt 1–245 Author chain G； PDBConstruct 1–245； UniProt 1–245 Author chain H； PDBConstruct 1–245； UniProt 1–245 Author chain I； PDBConstruct 1–245； UniProt 1–245 Author chain J； PDBConstruct 1–245； UniProt 1–245

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain K； PDBConstruct 1–104； UniProt 1–104 Author chain L； PDBConstruct 1–104； UniProt 1–104 Author chain M； PDBConstruct 1–104； UniProt 1–104 Author chain N； PDBConstruct 1–104； UniProt 1–104 Author chain O； PDBConstruct 1–104； UniProt 1–104 Author chain P； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Q； PDBConstruct 1–138； UniProt 1–138 Author chain R； PDBConstruct 1–138； UniProt 1–138 Author chain S； PDBConstruct 1–138； UniProt 1–138 Author chain T； PDBConstruct 1–138； UniProt 1–138 Author chain U； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar M-ring protein × 11 （P15928） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain V； PDBConstruct 1–134； UniProt 1–134 Author chain W； PDBConstruct 1–134； UniProt 1–134 Author chain X； PDBConstruct 1–134； UniProt 1–134 Author chain Y； PDBConstruct 1–134； UniProt 1–134 Author chain Z； PDBConstruct 1–134； UniProt 1–134 Author chain a； PDBConstruct 1–134； UniProt 1–134

Flagellar M-ring protein

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain b； PDBConstruct 1–560； UniProt 1–560 Author chain c； PDBConstruct 1–560； UniProt 1–560 Author chain d； PDBConstruct 1–560； UniProt 1–560 Author chain e； PDBConstruct 1–560； UniProt 1–560 Author chain f； PDBConstruct 1–560； UniProt 1–560 Author chain g； PDBConstruct 1–560； UniProt 1–560 Author chain h； PDBConstruct 1–560； UniProt 1–560 Author chain i； PDBConstruct 1–560； UniProt 1–560 Author chain j； PDBConstruct 1–560； UniProt 1–560 Author chain k； PDBConstruct 1–560； UniProt 1–560 Author chain l； PDBConstruct 1–560； UniProt 1–560

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt P16323

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 96	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar M-ring protein × 11 （P15928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGF_SALTY
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain m； PDBConstruct 1–251； UniProt 1–251 Author chain n； PDBConstruct 1–251； UniProt 1–251 Author chain o； PDBConstruct 1–251； UniProt 1–251 Author chain p； PDBConstruct 1–251； UniProt 1–251 Author chain q； PDBConstruct 1–251； UniProt 1–251

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wlq
Deposition date deposition_date	2023-09-30
Structure title title	Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state.
Keywords keywords	Flagellum, Flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wlq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wlq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wlq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	121.40 Å
Total Rg	121.70 Å
Atom count	167758
Residues	22615
Excluded volume	2960200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wlq__assembly_1__model_1`	96-meric （96）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4,5,6,7,8,9,ZA,ZB,ZC,ZD,ZE,r,s,t,u,v,w,x,y,z
Atom count atom_count	167758

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 2 Entity 2 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	29

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ZF,ZG,ZH,ZI,ZJ,ZK,ZL,ZM,ZN,ZO,ZP,ZQ,ZR,ZS,ZT,ZU,ZV,ZW,ZX,ZY,ZZ,Za,Zb,Zc,Zd,Ze,Zf,Zg,Zh

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 5 Entity 5 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,I,J

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 6 Entity 6 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 7 Entity 7 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T,U

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 8 Entity 8 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X,Y,Z,a

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 9 Entity 9 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c,d,e,f,g,h,i,j,k,l

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 10 Entity 10 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,n,o,p,q

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11858

Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer