SAXSdb — 7cg0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar MS ring L1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar MS ring L2 × 5 Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 5； PDBConstruct 1–21； UniProt 311–331 Author chain 6； PDBConstruct 1–21； UniProt 311–331 Author chain 7； PDBConstruct 1–21； UniProt 311–331 Author chain 8； PDBConstruct 1–21； UniProt 311–331 Author chain 9； PDBConstruct 1–21； UniProt 311–331

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal body rod protein FlgB × 5 （P16437）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain f； PDBConstruct 1–134； UniProt 1–134 Author chain g； PDBConstruct 1–134； UniProt 1–134 Author chain h； PDBConstruct 1–134； UniProt 1–134 Author chain i； PDBConstruct 1–134； UniProt 1–134 Author chain j； PDBConstruct 1–134； UniProt 1–134 Author chain p； PDBConstruct 1–134； UniProt 1–134

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain k； PDBConstruct 1–138； UniProt 1–138 Author chain l； PDBConstruct 1–138； UniProt 1–138 Author chain m； PDBConstruct 1–138； UniProt 1–138 Author chain n； PDBConstruct 1–138； UniProt 1–138 Author chain o； PDBConstruct 1–138； UniProt 1–138

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7cg0
Deposition date deposition_date	2020-06-30
Structure title title	Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella
Keywords keywords	Proximal rod, FlgC, FlgB, FliF, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7cg0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7cg0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7cg0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.97 Å
Rg (electron density)	38.18 Å
Total Rg	38.58 Å
Atom count	10928
Residues	1487
Excluded volume	193860 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7cg0__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Flagellar MS ring L2
Molecular weight formula_weight	1294.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4
Atom count atom_count	10928

XXXXXXXXXXXXXXX

Entity 2 Entity 2 polymer

Description description	Flagellar MS ring L1
Molecular weight formula_weight	1998.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6,7,9,8

GVPGALSNQPAPPNEAPIATP

Entity 3 Entity 3 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,g,h,j,p,i

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 4 Entity 4 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,m,o,k,n

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	148517

Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar MS ring L1

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7cg0__assembly_1__model_1

7cg0__assembly_1__model_1 | I(q)

7cg0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar MS ring L1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7cg0__assembly_1__model_1

7cg0__assembly_1__model_1 | I(q)

7cg0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

7. Citations (1)