8wkq

Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state.

Method: ELECTRON MICROSCOPY D_max: 279.3 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain 0； UniProt 1–560 Chain 1； UniProt 1–560 Chain 2； UniProt 1–560 Chain 3； UniProt 1–560 Chain 4； UniProt 1–560 Chain 5； UniProt 1–560 Chain 6； UniProt 1–560 Chain 7； UniProt 1–560 Chain 8； UniProt 1–560 Chain 9； UniProt 1–560 Chain AA； UniProt 1–560 Chain AB； UniProt 1–560 Chain AC； UniProt 1–560 Chain AD； UniProt 1–560 Chain AE； UniProt 1–560 Chain AF； UniProt 1–560 Chain AG； UniProt 1–560 Chain AH； UniProt 1–560 Chain AI； UniProt 1–560 Chain AJ； UniProt 1–560 Chain AK； UniProt 1–560 Chain AL； UniProt 1–560 Chain AM； UniProt 1–560 Chain AN； UniProt 1–560 Chain AO； UniProt 1–560 Chain AP； UniProt 1–560 Chain AQ； UniProt 1–560 Chain UI； UniProt 1–560 Chain UJ； UniProt 1–560 Chain UK； UniProt 1–560 Chain UL； UniProt 1–560 Chain UM； UniProt 1–560 Chain UN； UniProt 1–560 Chain UO； UniProt 1–560 Chain UP； UniProt 1–560 Chain WA； UniProt 1–560 Chain WB； UniProt 1–560 Chain WC； UniProt 1–560 Chain WD； UniProt 1–560 Chain WE； UniProt 1–560 Chain WF； UniProt 1–560 Chain WG； UniProt 1–560 Chain WH； UniProt 1–560 Chain WI； UniProt 1–560 Chain WJ； UniProt 1–560 Chain WK； UniProt 1–560 Chain WL； UniProt 1–560 Chain WM； UniProt 1–560 Chain WN； UniProt 1–560 Chain WO； UniProt 1–560 Chain WP； UniProt 1–560 Chain WQ； UniProt 1–560 Chain WR； UniProt 1–560 Chain WS； UniProt 1–560 Chain WT； UniProt 1–560 Chain WU； UniProt 1–560 Chain WV； UniProt 1–560 Chain WW； UniProt 1–560 Chain b； UniProt 1–560 Chain c； UniProt 1–560 Chain d； UniProt 1–560 Chain e； UniProt 1–560 Chain f； UniProt 1–560 Chain g； UniProt 1–560 Chain h； UniProt 1–560 Chain i； UniProt 1–560 Chain j； UniProt 1–560 Chain k； UniProt 1–560 Chain l； UniProt 1–560 Chain t； UniProt 1–560 Chain u； UniProt 1–560 Chain v； UniProt 1–560 Chain w； UniProt 1–560 Chain x； UniProt 1–560 Chain y； UniProt 1–560 Chain z； UniProt 1–560	Not recorded	Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6SD1 Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 33-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
6SD2 Structure of the RBM2inner region of the Salmonella flagella MS-ring protein FliF with 21-fold symmetry applied. Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 21 PDB declaration: 21-meric	Chain A 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain L 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain W 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6SD3 34mer structure of the Salmonella flagella MS-ring protein FliF Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6SD4 Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 34-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
6SD5 Structure of the RBM2 inner ring of Salmonella flagella MS-ring protein FliF with 22-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain R 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6TRE Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 32-fold symmetry applied Deposited 2019-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 32 PDB declaration: 32-meric	Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7BK0 Salmonella FliF ring (34mer) in intact basal body - C1 Deposited 2021-01-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CG7 Cryo-EM structure of the flagellar MS ring with C34 symmetry from Salmonella Deposited 2020-06-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.61 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa） Chain Ca 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Cc 1–560（560 aa） Chain Cd 1–560（560 aa） Chain Ce 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cg 1–560（560 aa） Chain Ch 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cj 1–560（560 aa） Chain Ck 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cm 1–560（560 aa） Chain Cn 1–560（560 aa） Chain Co 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cq 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cs 1–560（560 aa） Chain Ct 1–560（560 aa） Chain Cu 1–560（560 aa） Chain Cv 1–560（560 aa） Chain Cw 1–560（560 aa） Chain Cx 1–560（560 aa） Chain Cy 1–560（560 aa） Chain Cz 1–560（560 aa） Chain Da 1–560（560 aa） Chain Db 1–560（560 aa） Chain Dc 1–560（560 aa） Chain Dd 1–560（560 aa） Chain De 1–560（560 aa） Chain Df 1–560（560 aa） Chain Dg 1–560（560 aa） Chain Dh 1–560（560 aa） Chain Di 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dk 1–560（560 aa） Chain Dl 1–560（560 aa） Chain Dm 1–560（560 aa） Chain Dn 1–560（560 aa） Chain Do 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dq 1–560（560 aa） Chain Dr 1–560（560 aa） Chain Ds 1–560（560 aa） Chain Dt 1–560（560 aa） Chain Du 1–560（560 aa） Chain Dv 1–560（560 aa） Chain Dw 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Eh 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7D84 34-fold symmetry Salmonella S ring formed by full-length FliF Deposited 2020-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
7E81 Cryo-EM structure of the flagellar MS ring with FlgB-Dc loop and FliE-helix 1 from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 68 PDB declaration: 68-meric	Chain Ca 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Cc 1–560（560 aa） Chain Cd 1–560（560 aa） Chain Ce 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Ch 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cj 1–560（560 aa） Chain Ck 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cm 1–560（560 aa） Chain Cn 1–560（560 aa） Chain Co 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cq 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cs 1–560（560 aa） Chain Ct 1–560（560 aa） Chain Cu 1–560（560 aa） Chain Cv 1–560（560 aa） Chain Cw 1–560（560 aa） Chain Cx 1–560（560 aa） Chain Cy 1–560（560 aa） Chain Cz 1–560（560 aa） Chain Da 1–560（560 aa） Chain Db 1–560（560 aa） Chain Dc 1–560（560 aa） Chain Dd 1–560（560 aa） Chain De 1–560（560 aa） Chain Df 1–560（560 aa） Chain Dg 1–560（560 aa） Chain Dh 1–560（560 aa） Chain Di 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dk 1–560（560 aa） Chain Dl 1–560（560 aa） Chain Dm 1–560（560 aa） Chain Dn 1–560（560 aa） Chain Do 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dq 1–560（560 aa） Chain Dr 1–560（560 aa） Chain Ds 1–560（560 aa） Chain Dt 1–560（560 aa） Chain Du 1–560（560 aa） Chain Dv 1–560（560 aa） Chain Dw 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Fh 1–560（560 aa） Chain cg 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 4.50 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
7NVG Salmonella flagellar basal body refined in C1 map Deposited 2021-03-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 147 PDB declaration: 147-meric	Chain A1 1–560（560 aa） Chain B1 1–560（560 aa） Chain C1 1–560（560 aa） Chain D1 1–560（560 aa） Chain E1 1–560（560 aa） Chain F1 1–560（560 aa） Chain G1 1–560（560 aa） Chain H1 1–560（560 aa） Chain I1 1–560（560 aa） Chain J1 1–560（560 aa） Chain K1 1–560（560 aa） Chain L1 1–560（560 aa） Chain M1 1–560（560 aa） Chain N1 1–560（560 aa） Chain O1 1–560（560 aa） Chain P1 1–560（560 aa） Chain Q1 1–560（560 aa） Chain R1 1–560（560 aa） Chain S1 1–560（560 aa） Chain T1 1–560（560 aa） Chain U1 1–560（560 aa） Chain V1 1–560（560 aa） Chain W1 1–560（560 aa） Chain X1 1–560（560 aa） Chain Y1 1–560（560 aa） Chain Z1 1–560（560 aa） Chain a1 1–560（560 aa） Chain b1 1–560（560 aa） Chain c1 1–560（560 aa） Chain d1 1–560（560 aa） Chain e1 1–560（560 aa） Chain f1 1–560（560 aa） Chain g1 1–560（560 aa） Chain h1 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8FTE CryoEM strucutre of 22-mer RBM2 of the Salmonella MS-ring Deposited 2023-01-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1 % Ana-grade LDAO cryo-EM vitrification conditions Cryogen ETHANE；Purified MS-rings were added to each grid at 277.15K at 100% humidity. After 30 sec of incubation, blotting was performed for 12 sec. The grid was then plunged into liquid ethane using a Vitrobot Mark IV system (Thermo Fisher)	Resolution 3.80 Å
8FTF CryoEM strucutre of 33-mer RBM3 of the Salmonella MS-ring Deposited 2023-01-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain AA 1–560（560 aa） Chain B 1–560（560 aa） Chain BA 1–560（560 aa） Chain C 1–560（560 aa） Chain CA 1–560（560 aa） Chain D 1–560（560 aa） Chain DA 1–560（560 aa） Chain E 1–560（560 aa） Chain EA 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain G 1–560（560 aa） Chain GA 1–560（560 aa） Chain H 1–560（560 aa） Chain HA 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1 % Ana-grade LDAO cryo-EM vitrification conditions Cryogen ETHANE；Purified MS-rings were added to each grid at 277.15K at 100% humidity. After 30 sec of incubation, blotting was performed for 12 sec. The grid was then plunged into liquid ethane using a Vitrobot Mark IV system (Thermo Fisher)	Resolution 2.90 Å
8T8P 33-mer FliF MS-ring from Salmonella Deposited 2023-06-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain AA 1–560（560 aa） Chain B 1–560（560 aa） Chain BA 1–560（560 aa） Chain C 1–560（560 aa） Chain CA 1–560（560 aa） Chain D 1–560（560 aa） Chain DA 1–560（560 aa） Chain E 1–560（560 aa） Chain EA 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain G 1–560（560 aa） Chain GA 1–560（560 aa） Chain H 1–560（560 aa） Chain HA 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8UMD Cryo-EM structure of a single subunit of a Counterclockwise-locked form of the Salmonella enterica Typhimurium flagellar C-ring. Deposited 2023-10-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8UMX Cryo-EM structure of a single subunit of a Clockwise-locked form of the Salmonella enterica Typhimurium flagellar C-ring. Deposited 2023-10-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8UOX Cryo-EM structure of a Counterclockwise locked form of the Salmonella enterica Typhimurium flagellar C-ring, with C34 symmetry applied Deposited 2023-10-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A1 1–560（560 aa） Chain A2 1–560（560 aa） Chain A3 1–560（560 aa） Chain A4 1–560（560 aa） Chain A5 1–560（560 aa） Chain A6 1–560（560 aa） Chain A7 1–560（560 aa） Chain A8 1–560（560 aa） Chain A9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8UPL Cryo-EM structure of a Clockwise locked form of the Salmonella enterica Typhimurium flagellar C-ring, with C34 symmetry applied Deposited 2023-10-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A1 1–560（560 aa） Chain A2 1–560（560 aa） Chain A3 1–560（560 aa） Chain A4 1–560（560 aa） Chain A5 1–560（560 aa） Chain A6 1–560（560 aa） Chain A7 1–560（560 aa） Chain A8 1–560（560 aa） Chain A9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8VIB CW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming single subunit of the C-ring from Salmonella Deposited 2024-01-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8VID CW Flagellar Switch Complex with extra density - FliF, FliG, FliM, and FliN forming single subunit of the C-ring from Salmonella Deposited 2024-01-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8VKQ CW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming the C-ring from Salmonella Deposited 2024-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8VKR CW Flagellar Switch Complex with extra density - FliF, FliG, FliM, and FliN forming the C-ring from Salmonella Deposited 2024-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8WIW Cryo-EM structure of the flagellar C ring in the CW state Deposited 2023-09-25	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 238 PDB declaration: 238-meric	Chain A2 1–560（560 aa） Chain A9 1–560（560 aa） Chain B0 1–560（560 aa） Chain B3 1–560（560 aa） Chain BF 1–560（560 aa） Chain BM 1–560（560 aa） Chain BT 1–560（560 aa） Chain Ba 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bo 1–560（560 aa） Chain Bv 1–560（560 aa） Chain C 1–560（560 aa） Chain CG 1–560（560 aa） Chain CN 1–560（560 aa） Chain CU 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cw 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 5.60 Å
8WJR Cryo-EM structure of the MS ring (C34) within the flagellar motor-hook complex in the CW state Deposited 2023-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 2.90 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLI Cryo-EM structure of the MS ring (C34) within the flagellar motor-hook complex in the CCW state Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.20 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain 0 1–560（560 aa） Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain 7 1–560（560 aa） Chain 8 1–560（560 aa） Chain 9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa） Chain t 1–560（560 aa） Chain u 1–560（560 aa） Chain v 1–560（560 aa） Chain w 1–560（560 aa） Chain x 1–560（560 aa） Chain y 1–560（560 aa） Chain z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain B6 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain Bb 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bn 1–560（560 aa） Chain Bt 1–560（560 aa） Chain Bz 1–560（560 aa） Chain C3 1–560（560 aa） Chain C7 1–560（560 aa） Chain CB 1–560（560 aa） Chain CH 1–560（560 aa） Chain CN 1–560（560 aa） Chain CT 1–560（560 aa） Chain CZ 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cx 1–560（560 aa） Chain D2 1–560（560 aa） Chain D8 1–560（560 aa） Chain DE 1–560（560 aa） Chain DK 1–560（560 aa） Chain DR 1–560（560 aa） Chain DX 1–560（560 aa） Chain Dd 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dv 1–560（560 aa） Chain EF 1–560（560 aa） Chain EL 1–560（560 aa） Chain ER 1–560（560 aa） Chain EX 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Eh 1–560（560 aa） Chain En 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain B0 1–560（560 aa） Chain B3 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain Ba 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bo 1–560（560 aa） Chain Bv 1–560（560 aa） Chain CG 1–560（560 aa） Chain CN 1–560（560 aa） Chain CU 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cw 1–560（560 aa） Chain DE 1–560（560 aa） Chain DL 1–560（560 aa） Chain EH 1–560（560 aa） Chain EO 1–560（560 aa） Chain EV 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Eh 1–560（560 aa） Chain Ei 1–560（560 aa） Chain Ej 1–560（560 aa） Chain Ek 1–560（560 aa） Chain El 1–560（560 aa） Chain Em 1–560（560 aa） Chain En 1–560（560 aa） Chain Eo 1–560（560 aa） Chain Ep 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
8XP0 Cryo-EM structure of the protomers of the C ring in the CCW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain N 1–560（560 aa） Chain T 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 4.00 Å
8XP1 Cryo-EM structure of the protomers of the C ring in the CW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.40 Å
8YJT Cryo-EM structure of the flagellar C ring in the CCW state Deposited 2024-03-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain 0 1–560（560 aa） Chain 4 1–560（560 aa） Chain A2 1–560（560 aa） Chain A8 1–560（560 aa） Chain AF 1–560（560 aa） Chain AL 1–560（560 aa） Chain AR 1–560（560 aa） Chain AX 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ap 1–560（560 aa） Chain Av 1–560（560 aa） Chain B6 1–560（560 aa） Chain BD 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BP 1–560（560 aa） Chain BV 1–560（560 aa） Chain Bb 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bn 1–560（560 aa） Chain Bt 1–560（560 aa） Chain Bz 1–560（560 aa） Chain CB 1–560（560 aa） Chain CH 1–560（560 aa） Chain CN 1–560（560 aa） Chain CT 1–560（560 aa） Chain CZ 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cx 1–560（560 aa） Chain l 1–560（560 aa） Chain r 1–560（560 aa） Chain x 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 5.90 Å
8ZDS Structure of the Salmonella flagellar MS-ring with C11 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8ZDT Structure of the RBM3 ring of Salmonella flagellar MS-ring protein FliF with C33 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8ZDU Structure of the RBM3 ring of Salmonella flagellar MS-ring protein FliF with C34 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9N49 C-ring - single subunit of the 34-mer CCW flagellar switch complex - FliF, FliG, FliM, and FliN from Salmonella Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9N4Z CCW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming 34-mer C-ring from Salmonella Deposited 2025-02-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

47 other PDB entries and 47 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–560； UniProt 1–560 Author chain 1； PDBConstruct 1–560； UniProt 1–560 Author chain 2； PDBConstruct 1–560； UniProt 1–560 Author chain 3； PDBConstruct 1–560； UniProt 1–560 Author chain 4； PDBConstruct 1–560； UniProt 1–560 Author chain 5； PDBConstruct 1–560； UniProt 1–560 Author chain 6； PDBConstruct 1–560； UniProt 1–560 Author chain 7； PDBConstruct 1–560； UniProt 1–560 Author chain 8； PDBConstruct 1–560； UniProt 1–560 Author chain 9； PDBConstruct 1–560； UniProt 1–560 Author chain AA； PDBConstruct 1–560； UniProt 1–560 Author chain AB； PDBConstruct 1–560； UniProt 1–560 Author chain AC； PDBConstruct 1–560； UniProt 1–560 Author chain AD； PDBConstruct 1–560； UniProt 1–560 Author chain AE； PDBConstruct 1–560； UniProt 1–560 Author chain AF； PDBConstruct 1–560； UniProt 1–560 Author chain AG； PDBConstruct 1–560； UniProt 1–560 Author chain AH； PDBConstruct 1–560； UniProt 1–560 Author chain AI； PDBConstruct 1–560； UniProt 1–560 Author chain AJ； PDBConstruct 1–560； UniProt 1–560 Author chain AK； PDBConstruct 1–560； UniProt 1–560 Author chain AL； PDBConstruct 1–560； UniProt 1–560 Author chain AM； PDBConstruct 1–560； UniProt 1–560 Author chain AN； PDBConstruct 1–560； UniProt 1–560 Author chain AO； PDBConstruct 1–560； UniProt 1–560 Author chain AP； PDBConstruct 1–560； UniProt 1–560 Author chain AQ； PDBConstruct 1–560； UniProt 1–560 Author chain UI； PDBConstruct 1–560； UniProt 1–560 Author chain UJ； PDBConstruct 1–560； UniProt 1–560 Author chain UK； PDBConstruct 1–560； UniProt 1–560 Author chain UL； PDBConstruct 1–560； UniProt 1–560 Author chain UM； PDBConstruct 1–560； UniProt 1–560 Author chain UN； PDBConstruct 1–560； UniProt 1–560 Author chain UO； PDBConstruct 1–560； UniProt 1–560 Author chain UP； PDBConstruct 1–560； UniProt 1–560 Author chain WA； PDBConstruct 1–560； UniProt 1–560 Author chain WB； PDBConstruct 1–560； UniProt 1–560 Author chain WC； PDBConstruct 1–560； UniProt 1–560 Author chain WD； PDBConstruct 1–560； UniProt 1–560 Author chain WE； PDBConstruct 1–560； UniProt 1–560 Author chain WF； PDBConstruct 1–560； UniProt 1–560 Author chain WG； PDBConstruct 1–560； UniProt 1–560 Author chain WH； PDBConstruct 1–560； UniProt 1–560 Author chain WI； PDBConstruct 1–560； UniProt 1–560 Author chain WJ； PDBConstruct 1–560； UniProt 1–560 Author chain WK； PDBConstruct 1–560； UniProt 1–560 Author chain WL； PDBConstruct 1–560； UniProt 1–560 Author chain WM； PDBConstruct 1–560； UniProt 1–560 Author chain WN； PDBConstruct 1–560； UniProt 1–560 Author chain WO； PDBConstruct 1–560； UniProt 1–560 Author chain WP； PDBConstruct 1–560； UniProt 1–560 Author chain WQ； PDBConstruct 1–560； UniProt 1–560 Author chain WR； PDBConstruct 1–560； UniProt 1–560 Author chain WS； PDBConstruct 1–560； UniProt 1–560 Author chain WT； PDBConstruct 1–560； UniProt 1–560 Author chain WU； PDBConstruct 1–560； UniProt 1–560 Author chain WV； PDBConstruct 1–560； UniProt 1–560 Author chain WW； PDBConstruct 1–560； UniProt 1–560 Author chain b； PDBConstruct 1–560； UniProt 1–560 Author chain c； PDBConstruct 1–560； UniProt 1–560 Author chain d； PDBConstruct 1–560； UniProt 1–560 Author chain e； PDBConstruct 1–560； UniProt 1–560 Author chain f； PDBConstruct 1–560； UniProt 1–560 Author chain g； PDBConstruct 1–560； UniProt 1–560 Author chain h； PDBConstruct 1–560； UniProt 1–560 Author chain i； PDBConstruct 1–560； UniProt 1–560 Author chain j； PDBConstruct 1–560； UniProt 1–560 Author chain k； PDBConstruct 1–560； UniProt 1–560 Author chain l； PDBConstruct 1–560； UniProt 1–560 Author chain t； PDBConstruct 1–560； UniProt 1–560 Author chain u； PDBConstruct 1–560； UniProt 1–560 Author chain v； PDBConstruct 1–560； UniProt 1–560 Author chain w； PDBConstruct 1–560； UniProt 1–560 Author chain x； PDBConstruct 1–560； UniProt 1–560 Author chain y； PDBConstruct 1–560； UniProt 1–560 Author chain z； PDBConstruct 1–560； UniProt 1–560

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain A； UniProt 1–89 Chain B； UniProt 1–89 Chain C； UniProt 1–89 Chain D； UniProt 1–89	Not recorded	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CA 1–89（89 aa） Chain CB 1–89（89 aa） Chain CC 1–89（89 aa） Chain CD 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain CA 1–89（89 aa） Chain CB 1–89（89 aa） Chain CC 1–89（89 aa） Chain CD 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9K29 Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc Deposited 2024-10-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–89（89 aa） Chain H 1–89（89 aa） Chain I 1–89（89 aa） Chain J 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–89； UniProt 1–89 Author chain B； PDBConstruct 1–89； UniProt 1–89 Author chain C； PDBConstruct 1–89； UniProt 1–89 Author chain D； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain E； UniProt 1–264	Not recorded	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6F2D A FliPQR complex forms the core of the Salmonella type III secretion system export apparatus. Deposited 2017-11-24	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6R69 Improved map of the FliPQR complex that forms the core of the Salmonella type III secretion system export apparatus. Deposited 2019-03-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CE 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain CE 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9K29 Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc Deposited 2024-10-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain F； UniProt 1–245 Chain G； UniProt 1–245 Chain H； UniProt 1–245 Chain I； UniProt 1–245 Chain J； UniProt 1–245	Not recorded	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CG4 Cryo-EM structure of the flagellar export apparatus with FliE from Salmonella Deposited 2020-06-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain r 1–245（245 aa） Chain s 1–245（245 aa） Chain t 1–245（245 aa） Chain u 1–245（245 aa） Chain v 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.60 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CF 1–245（245 aa） Chain w 1–245（245 aa） Chain x 1–245（245 aa） Chain y 1–245（245 aa） Chain z 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain CF 1–245（245 aa） Chain w 1–245（245 aa） Chain x 1–245（245 aa） Chain y 1–245（245 aa） Chain z 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9K29 Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc Deposited 2024-10-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–245（245 aa） Chain B 1–245（245 aa） Chain C 1–245（245 aa） Chain D 1–245（245 aa） Chain E 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–245； UniProt 1–245 Author chain G； PDBConstruct 1–245； UniProt 1–245 Author chain H； PDBConstruct 1–245； UniProt 1–245 Author chain I； PDBConstruct 1–245； UniProt 1–245 Author chain J； PDBConstruct 1–245； UniProt 1–245

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain K； UniProt 1–104 Chain L； UniProt 1–104 Chain M； UniProt 1–104 Chain N； UniProt 1–104 Chain O； UniProt 1–104 Chain P； UniProt 1–104	Not recorded	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CG4 Cryo-EM structure of the flagellar export apparatus with FliE from Salmonella Deposited 2020-06-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain a 1–104（104 aa） Chain b 1–104（104 aa） Chain c 1–104（104 aa） Chain d 1–104（104 aa） Chain e 1–104（104 aa） Chain f 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.60 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain q 1–104（104 aa） Chain r 1–104（104 aa） Chain s 1–104（104 aa） Chain t 1–104（104 aa） Chain u 1–104（104 aa） Chain v 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain q 1–104（104 aa） Chain r 1–104（104 aa） Chain s 1–104（104 aa） Chain t 1–104（104 aa） Chain u 1–104（104 aa） Chain v 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain q 1–104（104 aa） Chain r 1–104（104 aa） Chain s 1–104（104 aa） Chain t 1–104（104 aa） Chain u 1–104（104 aa） Chain v 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain i 1–104（104 aa） Chain j 1–104（104 aa） Chain k 1–104（104 aa） Chain l 1–104（104 aa） Chain m 1–104（104 aa） Chain n 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K； PDBConstruct 1–104； UniProt 1–104 Author chain L； PDBConstruct 1–104； UniProt 1–104 Author chain M； PDBConstruct 1–104； UniProt 1–104 Author chain N； PDBConstruct 1–104； UniProt 1–104 Author chain O； PDBConstruct 1–104； UniProt 1–104 Author chain P； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain Q； UniProt 1–138 Chain R； UniProt 1–138 Chain S； UniProt 1–138 Chain T； UniProt 1–138 Chain U； UniProt 1–138	Not recorded	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain o 1–138（138 aa） Chain p 1–138（138 aa） Chain q 1–138（138 aa） Chain r 1–138（138 aa） Chain s 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Q； PDBConstruct 1–138； UniProt 1–138 Author chain R； PDBConstruct 1–138； UniProt 1–138 Author chain S； PDBConstruct 1–138； UniProt 1–138 Author chain T； PDBConstruct 1–138； UniProt 1–138 Author chain U； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 103 PDB declaration: 103-meric（103） Consistent with protein copy count	Chain V； UniProt 1–134 Chain W； UniProt 1–134 Chain X； UniProt 1–134 Chain Y； UniProt 1–134 Chain Z； UniProt 1–134 Chain a； UniProt 1–134	Not recorded	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8WKQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V； PDBConstruct 1–134； UniProt 1–134 Author chain W； PDBConstruct 1–134； UniProt 1–134 Author chain X； PDBConstruct 1–134； UniProt 1–134 Author chain Y； PDBConstruct 1–134； UniProt 1–134 Author chain Z； PDBConstruct 1–134； UniProt 1–134 Author chain a； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wkq
Deposition date deposition_date	2023-09-28
Structure title title	Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state.
Keywords keywords	Flagellum, Flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	79.27 Å
Radius of gyration Rg (electron density) rg_electron	78.54 Å
Forward intensity I(0) i0	28229700000.00
Molecular weight molecular_weight	1409900.0 kDa
Excluded volume excluded_volume	1758700 Å³
Envelope volume envelope_volume	2861100 Å³
Hydration-shell volume shell_volume	287680 Å³
Envelope diameter envelope_diameter	255.8 Å
Shell Rg shell_rg	88.55 Å
Envelope Rg envelope_rg	76.37 Å
Shape Rg shape_rg	78.57 Å
Total Rg total_rg	78.53 Å
Total atoms total_atoms	99073
Residues n_residues	12998
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	279.3 Å
Rg (real space) rg_real	81.53 Å
Rg uncertainty (real space) rg_real_error	1.37 Å
I(0) (real space) i0_real	2.8030e+10
I(0) uncertainty (real space) i0_real_error	5.5870e+08
Rg (reciprocal space) rg_reciprocal	80.45 Å
I(0) (reciprocal space) i0_reciprocal	28320000000.0000
Solution quality estimate total_estimate	0.9057
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	97.8 Å
Skewness Skewness skewness	0.388
Kurtosis Kurtosis kurtosis	0.109
Angular range angular_range	— – 0.1000 Å⁻¹
Current regularization parameter α current_alpha	1.1600
Highest regularization parameter α highest_alpha	5441000000.0000
Real-space data points n_real_points	21
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.759; Stabil: 0.909; Sysdev: 1.000; Positv: 1.000; Valcen: 0.944; Smooth: 0.840

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	76

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;UI,UJ,UK,UL,UM,UN,UO,UP,WA,WB,WC,WD,WE,WF,WG,WH,WI,WJ,WK,WL,WM,WN,WO,WP,WQ,WR,WS,WT,WU,WV,WW,b,c,d,e,f,g,h,i,j,k,l,t,u,v,w,x,y,z,1,2,3,4,5,6,7,8,9,0,AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ ;
Atom count atom_count	99073

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,I,J

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 5 Entity 5 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 6 Entity 6 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T,U

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 7 Entity 7 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X,Y,Z,a

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	24190

fit	/app/data/saxs_computation/wk/8wkq/8wkq.fit
pddf	/app/data/pr_computation/wk/8wkq/8wkq.pr.out
profile	/app/data/saxs_computation/wk/8wkq/8wkq.dat

Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)