SAXSdb — 8xp1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliN

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar M-ring protein × 3 （P15928） Flagellar motor switch protein FliM × 3 （P26418） Flagellar motor switch protein FliG × 3 （P0A1J9） Chemotaxis protein CheY × 3 （P0A2D5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIN_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–137； UniProt 1–137 Author chain AA； PDBConstruct 1–137； UniProt 1–137 Author chain AB； PDBConstruct 1–137； UniProt 1–137 Author chain o； PDBConstruct 1–137； UniProt 1–137 Author chain p； PDBConstruct 1–137； UniProt 1–137 Author chain q； PDBConstruct 1–137； UniProt 1–137 Author chain u； PDBConstruct 1–137； UniProt 1–137 Author chain v； PDBConstruct 1–137； UniProt 1–137 Author chain w； PDBConstruct 1–137； UniProt 1–137

Flagellar M-ring protein

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar motor switch protein FliN × 9 （P26419） Flagellar motor switch protein FliM × 3 （P26418） Flagellar motor switch protein FliG × 3 （P0A1J9） Chemotaxis protein CheY × 3 （P0A2D5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–560； UniProt 1–560 Author chain D； PDBConstruct 1–560； UniProt 1–560 Author chain E； PDBConstruct 1–560； UniProt 1–560

Flagellar motor switch protein FliM

OrganismNot specified

UniProt P26418

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar motor switch protein FliN × 9 （P26419） Flagellar M-ring protein × 3 （P15928） Flagellar motor switch protein FliG × 3 （P0A1J9） Chemotaxis protein CheY × 3 （P0A2D5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIM_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain S； PDBConstruct 1–334； UniProt 1–334 Author chain T； PDBConstruct 1–334； UniProt 1–334 Author chain U； PDBConstruct 1–334； UniProt 1–334

Flagellar motor switch protein FliG

OrganismNot specified

UniProt P0A1J9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar motor switch protein FliN × 9 （P26419） Flagellar M-ring protein × 3 （P15928） Flagellar motor switch protein FliM × 3 （P26418） Chemotaxis protein CheY × 3 （P0A2D5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIG_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Z； PDBConstruct 1–331； UniProt 1–331 Author chain a； PDBConstruct 1–331； UniProt 1–331 Author chain b； PDBConstruct 1–331； UniProt 1–331

Chemotaxis protein CheY

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

UniProt P0A2D5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Flagellar motor switch protein FliN × 9 （P26419） Flagellar M-ring protein × 3 （P15928） Flagellar motor switch protein FliM × 3 （P26418） Flagellar motor switch protein FliG × 3 （P0A1J9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHEY_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain h； PDBConstruct 1–129； UniProt 1–129 Author chain i； PDBConstruct 1–129； UniProt 1–129 Author chain j； PDBConstruct 1–129； UniProt 1–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xp1
Deposition date deposition_date	2024-01-02
Structure title title	Cryo-EM structure of the protomers of the C ring in the CW state
Keywords keywords	Flagellum, Flagellar motor, C ring, CheY, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8xp1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8xp1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8xp1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.17 Å
Rg (electron density)	57.07 Å
Total Rg	57.30 Å
Atom count	24297
Residues	3084
Excluded volume	436650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8xp1__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Flagellar motor switch protein FliN
Molecular weight formula_weight	14801.8 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,o,u,AA,p,v,AB,q,w
Atom count atom_count	24297

MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGGGDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

Entity 2 Entity 2 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 3 Entity 3 polymer

Description description	Flagellar motor switch protein FliM
Molecular weight formula_weight	37901.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U

MGDSILSQAEIDALLNGDSDTKDEPTPGIASDSDIRPYDPNTQRRVVRERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFADIPLRLSQILKLKPGDVLPIEKPDRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINPILNSLNEEQPK

Entity 4 Entity 4 polymer

Description description	Flagellar motor switch protein FliG
Molecular weight formula_weight	36891.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,a,b

MSNLSGTDKSVILLMTIGEDRAAEVFKHLSTREVQALSTAMANVRQISNKQLTDVLSEFEQEAEQFAALNINANEYLRSVLVKALGEERASSLLEDILETRDTTSGIETLNFMEPQSAADLIRDEHPQIIATILVHLKRSQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDGQNLKRSKMGGVRTAAEIINLMKTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEPPLREKFLRNMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSGEDTYV

Entity 5 Entity 5 polymer

Description description	Chemotaxis protein CheY
Molecular weight formula_weight	14177.5 kDa
Mutation mutation	D13K, Y106W
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,i,j

MADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	956046

Cryo-EM structure of the protomers of the C ring in the CW state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliN

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar motor switch protein FliM

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar motor switch protein FliG

State in the Current Structure

Other States of the Same Protein in the Database

Chemotaxis protein CheY

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xp1__assembly_1__model_1

8xp1__assembly_1__model_1 | I(q)

8xp1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of the protomers of the C ring in the CW state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar motor switch protein FliM

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar motor switch protein FliG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chemotaxis protein CheY

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xp1__assembly_1__model_1

8xp1__assembly_1__model_1 | I(q)

8xp1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)