7nvg

Salmonella flagellar basal body refined in C1 map

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A1； PDBConstruct 1–560； UniProt 1–560 Author chain B1； PDBConstruct 1–560； UniProt 1–560 Author chain C1； PDBConstruct 1–560； UniProt 1–560 Author chain D1； PDBConstruct 1–560； UniProt 1–560 Author chain E1； PDBConstruct 1–560； UniProt 1–560 Author chain F1； PDBConstruct 1–560； UniProt 1–560 Author chain G1； PDBConstruct 1–560； UniProt 1–560 Author chain H1； PDBConstruct 1–560； UniProt 1–560 Author chain I1； PDBConstruct 1–560； UniProt 1–560 Author chain J1； PDBConstruct 1–560； UniProt 1–560 Author chain K1； PDBConstruct 1–560； UniProt 1–560 Author chain L1； PDBConstruct 1–560； UniProt 1–560 Author chain M1； PDBConstruct 1–560； UniProt 1–560 Author chain N1； PDBConstruct 1–560； UniProt 1–560 Author chain O1； PDBConstruct 1–560； UniProt 1–560 Author chain P1； PDBConstruct 1–560； UniProt 1–560 Author chain Q1； PDBConstruct 1–560； UniProt 1–560 Author chain R1； PDBConstruct 1–560； UniProt 1–560 Author chain S1； PDBConstruct 1–560； UniProt 1–560 Author chain T1； PDBConstruct 1–560； UniProt 1–560 Author chain U1； PDBConstruct 1–560； UniProt 1–560 Author chain V1； PDBConstruct 1–560； UniProt 1–560 Author chain W1； PDBConstruct 1–560； UniProt 1–560 Author chain X1； PDBConstruct 1–560； UniProt 1–560 Author chain Y1； PDBConstruct 1–560； UniProt 1–560 Author chain Z1； PDBConstruct 1–560； UniProt 1–560 Author chain a1； PDBConstruct 1–560； UniProt 1–560 Author chain b1； PDBConstruct 1–560； UniProt 1–560 Author chain c1； PDBConstruct 1–560； UniProt 1–560 Author chain d1； PDBConstruct 1–560； UniProt 1–560 Author chain e1； PDBConstruct 1–560； UniProt 1–560 Author chain f1； PDBConstruct 1–560； UniProt 1–560 Author chain g1； PDBConstruct 1–560； UniProt 1–560 Author chain h1； PDBConstruct 1–560； UniProt 1–560

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt A0A0D6FLD2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D6FLD2_SALTM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A2； PDBConstruct 1–245； UniProt 1–245 Author chain B2； PDBConstruct 1–245； UniProt 1–245 Author chain C2； PDBConstruct 1–245； UniProt 1–245 Author chain D2； PDBConstruct 1–245； UniProt 1–245 Author chain E2； PDBConstruct 1–245； UniProt 1–245

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt A0A0D6FLB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D6FLB3_SALTM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F2； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt A0A0F7J7J8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F7J7J8_SALTM
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G2； PDBConstruct 1–89； UniProt 1–89 Author chain H2； PDBConstruct 1–89； UniProt 1–89 Author chain I2； PDBConstruct 1–89； UniProt 1–89 Author chain J2； PDBConstruct 1–89； UniProt 1–89

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt A0A0D6FLN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D6FLN2_SALTM
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K2； PDBConstruct 1–104； UniProt 1–104 Author chain L2； PDBConstruct 1–104； UniProt 1–104 Author chain M2； PDBConstruct 1–104； UniProt 1–104 Author chain N2； PDBConstruct 1–104； UniProt 1–104 Author chain O2； PDBConstruct 1–104； UniProt 1–104 Author chain P2； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt A0A0D6GKK7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D6GKK7_SALTM
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Q2； PDBConstruct 1–138； UniProt 1–138 Author chain R2； PDBConstruct 1–138； UniProt 1–138 Author chain S2； PDBConstruct 1–138； UniProt 1–138 Author chain T2； PDBConstruct 1–138； UniProt 1–138 Author chain U2； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt A0A0F7J5J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F7J5J2_SALTM
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V2； PDBConstruct 1–134； UniProt 1–134 Author chain W2； PDBConstruct 1–134； UniProt 1–134 Author chain X2； PDBConstruct 1–134； UniProt 1–134 Author chain Y2； PDBConstruct 1–134； UniProt 1–134 Author chain Z2； PDBConstruct 1–134； UniProt 1–134 Author chain a2； PDBConstruct 1–134； UniProt 1–134

Flagellar basal body protein

OrganismNot specified

UniProt A0A0D6GIC9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D6GIC9_SALTM
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain b2； PDBConstruct 1–251； UniProt 1–251 Author chain c2； PDBConstruct 1–251； UniProt 1–251 Author chain d2； PDBConstruct 1–251； UniProt 1–251 Author chain e2； PDBConstruct 1–251； UniProt 1–251 Author chain f2； PDBConstruct 1–251； UniProt 1–251

Flagellar basal-body rod protein FlgG

OrganismNot specified

UniProt A0A0F7J893

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F7J893_SALTM
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 12； PDBConstruct 1–260； UniProt 1–260 Author chain 22； PDBConstruct 1–260； UniProt 1–260 Author chain 32； PDBConstruct 1–260； UniProt 1–260 Author chain 42； PDBConstruct 1–260； UniProt 1–260 Author chain g2； PDBConstruct 1–260； UniProt 1–260 Author chain h2； PDBConstruct 1–260； UniProt 1–260 Author chain i2； PDBConstruct 1–260； UniProt 1–260 Author chain j2； PDBConstruct 1–260； UniProt 1–260 Author chain k2； PDBConstruct 1–260； UniProt 1–260 Author chain l2； PDBConstruct 1–260； UniProt 1–260 Author chain m2； PDBConstruct 1–260； UniProt 1–260 Author chain n2； PDBConstruct 1–260； UniProt 1–260 Author chain o2； PDBConstruct 1–260； UniProt 1–260 Author chain p2； PDBConstruct 1–260； UniProt 1–260 Author chain q2； PDBConstruct 1–260； UniProt 1–260 Author chain r2； PDBConstruct 1–260； UniProt 1–260 Author chain s2； PDBConstruct 1–260； UniProt 1–260 Author chain t2； PDBConstruct 1–260； UniProt 1–260 Author chain u2； PDBConstruct 1–260； UniProt 1–260 Author chain v2； PDBConstruct 1–260； UniProt 1–260 Author chain w2； PDBConstruct 1–260； UniProt 1–260 Author chain x2； PDBConstruct 1–260； UniProt 1–260 Author chain y2； PDBConstruct 1–260； UniProt 1–260 Author chain z2； PDBConstruct 1–260； UniProt 1–260

Flagellar L-ring protein

OrganismNot specified

UniProt A0A0J5DWE9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar P-ring protein × 26 （A0A0F7J5J5） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0J5DWE9_SALTM
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A3； PDBConstruct 1–232； UniProt 1–232 Author chain B3； PDBConstruct 1–232； UniProt 1–232 Author chain C3； PDBConstruct 1–232； UniProt 1–232 Author chain D3； PDBConstruct 1–232； UniProt 1–232 Author chain E3； PDBConstruct 1–232； UniProt 1–232 Author chain F3； PDBConstruct 1–232； UniProt 1–232 Author chain G3； PDBConstruct 1–232； UniProt 1–232 Author chain H3； PDBConstruct 1–232； UniProt 1–232 Author chain I3； PDBConstruct 1–232； UniProt 1–232 Author chain J3； PDBConstruct 1–232； UniProt 1–232 Author chain K3； PDBConstruct 1–232； UniProt 1–232 Author chain L3； PDBConstruct 1–232； UniProt 1–232 Author chain M3； PDBConstruct 1–232； UniProt 1–232 Author chain N3； PDBConstruct 1–232； UniProt 1–232 Author chain O3； PDBConstruct 1–232； UniProt 1–232 Author chain P3； PDBConstruct 1–232； UniProt 1–232 Author chain Q3； PDBConstruct 1–232； UniProt 1–232 Author chain R3； PDBConstruct 1–232； UniProt 1–232 Author chain S3； PDBConstruct 1–232； UniProt 1–232 Author chain T3； PDBConstruct 1–232； UniProt 1–232 Author chain U3； PDBConstruct 1–232； UniProt 1–232 Author chain V3； PDBConstruct 1–232； UniProt 1–232 Author chain W3； PDBConstruct 1–232； UniProt 1–232 Author chain X3； PDBConstruct 1–232； UniProt 1–232 Author chain Y3； PDBConstruct 1–232； UniProt 1–232 Author chain Z3； PDBConstruct 1–232； UniProt 1–232

Flagellar P-ring protein

OrganismNot specified

UniProt A0A0F7J5J5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Basal-body rod modification protein FlgD × 5 （A0A0F7J820）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F7J5J5_SALTM
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain a3； PDBConstruct 1–365； UniProt 1–365 Author chain b3； PDBConstruct 1–365； UniProt 1–365 Author chain c3； PDBConstruct 1–365； UniProt 1–365 Author chain d3； PDBConstruct 1–365； UniProt 1–365 Author chain e3； PDBConstruct 1–365； UniProt 1–365 Author chain f3； PDBConstruct 1–365； UniProt 1–365 Author chain g3； PDBConstruct 1–365； UniProt 1–365 Author chain h3； PDBConstruct 1–365； UniProt 1–365 Author chain i3； PDBConstruct 1–365； UniProt 1–365 Author chain j3； PDBConstruct 1–365； UniProt 1–365 Author chain k3； PDBConstruct 1–365； UniProt 1–365 Author chain l3； PDBConstruct 1–365； UniProt 1–365 Author chain m3； PDBConstruct 1–365； UniProt 1–365 Author chain n3； PDBConstruct 1–365； UniProt 1–365 Author chain o3； PDBConstruct 1–365； UniProt 1–365 Author chain p3； PDBConstruct 1–365； UniProt 1–365 Author chain q3； PDBConstruct 1–365； UniProt 1–365 Author chain r3； PDBConstruct 1–365； UniProt 1–365 Author chain s3； PDBConstruct 1–365； UniProt 1–365 Author chain t3； PDBConstruct 1–365； UniProt 1–365 Author chain u3； PDBConstruct 1–365； UniProt 1–365 Author chain v3； PDBConstruct 1–365； UniProt 1–365 Author chain w3； PDBConstruct 1–365； UniProt 1–365 Author chain x3； PDBConstruct 1–365； UniProt 1–365 Author chain y3； PDBConstruct 1–365； UniProt 1–365 Author chain z3； PDBConstruct 1–365； UniProt 1–365

Basal-body rod modification protein FlgD

OrganismNot specified

UniProt A0A0F7J820

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 147	Flagellar M-ring protein × 34 （P15928） Flagellar biosynthetic protein FliP × 5 （A0A0D6FLD2） Flagellar biosynthetic protein FliR × 1 （A0A0D6FLB3） Flagellar biosynthetic protein FliQ × 4 （A0A0F7J7J8） Flagellar hook-basal body complex protein FliE × 6 （A0A0D6FLN2） Flagellar basal body rod protein FlgB × 5 （A0A0D6GKK7） Flagellar basal-body rod protein FlgC × 6 （A0A0F7J5J2） Flagellar basal body protein × 5 （A0A0D6GIC9） Flagellar basal-body rod protein FlgG × 24 （A0A0F7J893） Flagellar L-ring protein × 26 （A0A0J5DWE9） Flagellar P-ring protein × 26 （A0A0F7J5J5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0F7J820_SALTM
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain A4； PDBConstruct 1–232； UniProt 1–232 Author chain B4； PDBConstruct 1–232； UniProt 1–232 Author chain C4； PDBConstruct 1–232； UniProt 1–232 Author chain D4； PDBConstruct 1–232； UniProt 1–232 Author chain E4； PDBConstruct 1–232； UniProt 1–232

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nvg
Deposition date deposition_date	2021-03-15
Structure title title	Salmonella flagellar basal body refined in C1 map
Keywords keywords	bacterial flagellum, flagella, basal body, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7nvg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7nvg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7nvg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	115.70 Å
Total Rg	115.60 Å
Atom count	246310
Residues	32749
Excluded volume	4355400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7nvg__assembly_1__model_1`	147-meric （147）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,B1,C1,D1,E1,F1,G1,H1,I1,J1,K1,L1,M1,N1,O1,P1,Q1,R1,S1,T1,U1,V1,W1,X1,Y1,Z1,a1,b1,c1,d1,e1,f1,g1,h1
Atom count atom_count	246311

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2,B2,C2,D2,E2

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F2

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G2,H2,I2,J2

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 5 Entity 5 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K2,L2,M2,N2,O2,P2

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 6 Entity 6 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q2,R2,S2,T2,U2

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 7 Entity 7 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V2,W2,X2,Y2,Z2,a2

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 8 Entity 8 polymer

Description description	Flagellar basal body protein
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b2,c2,d2,e2,f2

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 9 Entity 9 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g2,h2,i2,j2,k2,l2,m2,n2,o2,p2,q2,r2,s2,t2,u2,v2,w2,x2,y2,z2,12,22,32,42

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 10 Entity 10 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24726.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A3,B3,C3,D3,E3,F3,G3,H3,I3,J3,K3,L3,M3,N3,O3,P3,Q3,R3,S3,T3,U3,V3,W3,X3,Y3,Z3

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 11 Entity 11 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a3,b3,c3,d3,e3,f3,g3,h3,i3,j3,k3,l3,m3,n3,o3,p3,q3,r3,s3,t3,u3,v3,w3,x3,y3,z3

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

Entity 12 Entity 12 polymer

Description description	Basal-body rod modification protein FlgD
Molecular weight formula_weight	24001.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A4,B4,C4,D4,E4

MSIAVNMNDPTNTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGAISGQIDNSQSLQATTLIGHGVMVPGTTILAGKGAEEGAVTSTTPFGVELQQPADKVTATITDKDGRVVRTLEIGELRAGVHTFTWDGKQTDGTTVPNGSYNIAITASNGGTQLVAQPLQFALVQGVTKGSNGNLLDLGTYGTTTLDEVRQII

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	60497

Salmonella flagellar basal body refined in C1 map

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer