7cgo

Cryo-EM structure of the flagellar motor-hook complex from Salmonella

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGG_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–260； UniProt 1–260 Author chain B； PDBConstruct 1–260； UniProt 1–260 Author chain C； PDBConstruct 1–260； UniProt 1–260 Author chain D； PDBConstruct 1–260； UniProt 1–260 Author chain E； PDBConstruct 1–260； UniProt 1–260 Author chain F； PDBConstruct 1–260； UniProt 1–260 Author chain G； PDBConstruct 1–260； UniProt 1–260 Author chain H； PDBConstruct 1–260； UniProt 1–260 Author chain I； PDBConstruct 1–260； UniProt 1–260 Author chain J； PDBConstruct 1–260； UniProt 1–260 Author chain K； PDBConstruct 1–260； UniProt 1–260 Author chain L； PDBConstruct 1–260； UniProt 1–260 Author chain M； PDBConstruct 1–260； UniProt 1–260 Author chain N； PDBConstruct 1–260； UniProt 1–260 Author chain O； PDBConstruct 1–260； UniProt 1–260 Author chain P； PDBConstruct 1–260； UniProt 1–260 Author chain Q； PDBConstruct 1–260； UniProt 1–260 Author chain R； PDBConstruct 1–260； UniProt 1–260 Author chain S； PDBConstruct 1–260； UniProt 1–260 Author chain T； PDBConstruct 1–260； UniProt 1–260 Author chain U； PDBConstruct 1–260； UniProt 1–260 Author chain V； PDBConstruct 1–260； UniProt 1–260 Author chain W； PDBConstruct 1–260； UniProt 1–260 Author chain X； PDBConstruct 1–260； UniProt 1–260

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt P16323

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGF_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–251； UniProt 1–251 Author chain b； PDBConstruct 1–251； UniProt 1–251 Author chain c； PDBConstruct 1–251； UniProt 1–251 Author chain d； PDBConstruct 1–251； UniProt 1–251 Author chain e； PDBConstruct 1–251； UniProt 1–251

Flagellar MS ring L1

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	4, 12
Chains and sequence ranges	Author chain 5； PDBConstruct 1–21； UniProt 311–331 Author chain 6； PDBConstruct 1–21； UniProt 311–331 Author chain 7； PDBConstruct 1–21； UniProt 311–331 Author chain 8； PDBConstruct 1–21； UniProt 311–331 Author chain 9； PDBConstruct 1–21； UniProt 311–331 Author chain Ca； PDBConstruct 1–560； UniProt 1–560 Author chain Cb； PDBConstruct 1–560； UniProt 1–560 Author chain Cc； PDBConstruct 1–560； UniProt 1–560 Author chain Cd； PDBConstruct 1–560； UniProt 1–560 Author chain Ce； PDBConstruct 1–560； UniProt 1–560 Author chain Cf； PDBConstruct 1–560； UniProt 1–560 Author chain Cg； PDBConstruct 1–560； UniProt 1–560 Author chain Ch； PDBConstruct 1–560； UniProt 1–560 Author chain Ci； PDBConstruct 1–560； UniProt 1–560 Author chain Cj； PDBConstruct 1–560； UniProt 1–560 Author chain Ck； PDBConstruct 1–560； UniProt 1–560 Author chain Cl； PDBConstruct 1–560； UniProt 1–560 Author chain Cm； PDBConstruct 1–560； UniProt 1–560 Author chain Cn； PDBConstruct 1–560； UniProt 1–560 Author chain Co； PDBConstruct 1–560； UniProt 1–560 Author chain Cp； PDBConstruct 1–560； UniProt 1–560 Author chain Cq； PDBConstruct 1–560； UniProt 1–560 Author chain Cr； PDBConstruct 1–560； UniProt 1–560 Author chain Cs； PDBConstruct 1–560； UniProt 1–560 Author chain Ct； PDBConstruct 1–560； UniProt 1–560 Author chain Cu； PDBConstruct 1–560； UniProt 1–560 Author chain Cv； PDBConstruct 1–560； UniProt 1–560 Author chain Cw； PDBConstruct 1–560； UniProt 1–560 Author chain Cx； PDBConstruct 1–560； UniProt 1–560 Author chain Cy； PDBConstruct 1–560； UniProt 1–560 Author chain Cz； PDBConstruct 1–560； UniProt 1–560 Author chain Da； PDBConstruct 1–560； UniProt 1–560 Author chain Db； PDBConstruct 1–560； UniProt 1–560 Author chain Dc； PDBConstruct 1–560； UniProt 1–560 Author chain Dd； PDBConstruct 1–560； UniProt 1–560 Author chain De； PDBConstruct 1–560； UniProt 1–560 Author chain Df； PDBConstruct 1–560； UniProt 1–560 Author chain Dg； PDBConstruct 1–560； UniProt 1–560 Author chain Dh； PDBConstruct 1–560； UniProt 1–560 Author chain Di； PDBConstruct 1–560； UniProt 1–560 Author chain Dj； PDBConstruct 1–560； UniProt 1–560 Author chain Dk； PDBConstruct 1–560； UniProt 1–560 Author chain Dl； PDBConstruct 1–560； UniProt 1–560 Author chain Dm； PDBConstruct 1–560； UniProt 1–560 Author chain Dn； PDBConstruct 1–560； UniProt 1–560 Author chain Do； PDBConstruct 1–560； UniProt 1–560 Author chain Dp； PDBConstruct 1–560； UniProt 1–560 Author chain Dq； PDBConstruct 1–560； UniProt 1–560 Author chain Dr； PDBConstruct 1–560； UniProt 1–560 Author chain Ds； PDBConstruct 1–560； UniProt 1–560 Author chain Dt； PDBConstruct 1–560； UniProt 1–560 Author chain Du； PDBConstruct 1–560； UniProt 1–560 Author chain Dv； PDBConstruct 1–560； UniProt 1–560 Author chain Dw； PDBConstruct 1–560； UniProt 1–560 Author chain Ea； PDBConstruct 1–560； UniProt 1–560 Author chain Eb； PDBConstruct 1–560； UniProt 1–560 Author chain Ec； PDBConstruct 1–560； UniProt 1–560 Author chain Ed； PDBConstruct 1–560； UniProt 1–560 Author chain Ee； PDBConstruct 1–560； UniProt 1–560 Author chain Ef； PDBConstruct 1–560； UniProt 1–560 Author chain Eg； PDBConstruct 1–560； UniProt 1–560 Author chain Eh； PDBConstruct 1–560； UniProt 1–560

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain f； PDBConstruct 1–134； UniProt 1–134 Author chain g； PDBConstruct 1–134； UniProt 1–134 Author chain h； PDBConstruct 1–134； UniProt 1–134 Author chain i； PDBConstruct 1–134； UniProt 1–134 Author chain j； PDBConstruct 1–134； UniProt 1–134 Author chain p； PDBConstruct 1–134； UniProt 1–134

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain k； PDBConstruct 1–138； UniProt 1–138 Author chain l； PDBConstruct 1–138； UniProt 1–138 Author chain m； PDBConstruct 1–138； UniProt 1–138 Author chain n； PDBConstruct 1–138； UniProt 1–138 Author chain o； PDBConstruct 1–138； UniProt 1–138

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain q； PDBConstruct 1–104； UniProt 1–104 Author chain r； PDBConstruct 1–104； UniProt 1–104 Author chain s； PDBConstruct 1–104； UniProt 1–104 Author chain t； PDBConstruct 1–104； UniProt 1–104 Author chain u； PDBConstruct 1–104； UniProt 1–104 Author chain v； PDBConstruct 1–104； UniProt 1–104

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain DA； PDBConstruct 1–403； UniProt 1–403 Author chain DB； PDBConstruct 1–403； UniProt 1–403 Author chain DC； PDBConstruct 1–403； UniProt 1–403 Author chain DD； PDBConstruct 1–403； UniProt 1–403 Author chain DE； PDBConstruct 1–403； UniProt 1–403 Author chain DF； PDBConstruct 1–403； UniProt 1–403 Author chain DG； PDBConstruct 1–403； UniProt 1–403 Author chain DH； PDBConstruct 1–403； UniProt 1–403 Author chain DI； PDBConstruct 1–403； UniProt 1–403 Author chain DJ； PDBConstruct 1–403； UniProt 1–403 Author chain DK； PDBConstruct 1–403； UniProt 1–403 Author chain DL； PDBConstruct 1–403； UniProt 1–403 Author chain DM； PDBConstruct 1–403； UniProt 1–403 Author chain DN； PDBConstruct 1–403； UniProt 1–403 Author chain DO； PDBConstruct 1–403； UniProt 1–403 Author chain DP； PDBConstruct 1–403； UniProt 1–403 Author chain DQ； PDBConstruct 1–403； UniProt 1–403 Author chain DR； PDBConstruct 1–403； UniProt 1–403 Author chain DS； PDBConstruct 1–403； UniProt 1–403 Author chain DT； PDBConstruct 1–403； UniProt 1–403 Author chain DU； PDBConstruct 1–403； UniProt 1–403 Author chain DV； PDBConstruct 1–403； UniProt 1–403 Author chain DW； PDBConstruct 1–403； UniProt 1–403 Author chain DX； PDBConstruct 1–403； UniProt 1–403 Author chain DY； PDBConstruct 1–403； UniProt 1–403 Author chain DZ； PDBConstruct 1–403； UniProt 1–403 Author chain EA； PDBConstruct 1–403； UniProt 1–403 Author chain EB； PDBConstruct 1–403； UniProt 1–403 Author chain EC； PDBConstruct 1–403； UniProt 1–403 Author chain ED； PDBConstruct 1–403； UniProt 1–403 Author chain EE； PDBConstruct 1–403； UniProt 1–403 Author chain EF； PDBConstruct 1–403； UniProt 1–403 Author chain EG； PDBConstruct 1–403； UniProt 1–403

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain CE； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain CA； PDBConstruct 1–89； UniProt 1–89 Author chain CB； PDBConstruct 1–89； UniProt 1–89 Author chain CC； PDBConstruct 1–89； UniProt 1–89 Author chain CD； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain CF； PDBConstruct 1–245； UniProt 1–245 Author chain w； PDBConstruct 1–245； UniProt 1–245 Author chain x； PDBConstruct 1–245； UniProt 1–245 Author chain y； PDBConstruct 1–245； UniProt 1–245 Author chain z； PDBConstruct 1–245； UniProt 1–245

Flagellar L-ring protein

OrganismNot specified

UniProt P0A1N8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar P-ring protein × 26 （P15930）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGH_SALTY
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AA； PDBConstruct 1–232； UniProt 1–232 Author chain AB； PDBConstruct 1–232； UniProt 1–232 Author chain AC； PDBConstruct 1–232； UniProt 1–232 Author chain AD； PDBConstruct 1–232； UniProt 1–232 Author chain AE； PDBConstruct 1–232； UniProt 1–232 Author chain AF； PDBConstruct 1–232； UniProt 1–232 Author chain AG； PDBConstruct 1–232； UniProt 1–232 Author chain AH； PDBConstruct 1–232； UniProt 1–232 Author chain AI； PDBConstruct 1–232； UniProt 1–232 Author chain AJ； PDBConstruct 1–232； UniProt 1–232 Author chain AK； PDBConstruct 1–232； UniProt 1–232 Author chain AL； PDBConstruct 1–232； UniProt 1–232 Author chain AM； PDBConstruct 1–232； UniProt 1–232 Author chain AN； PDBConstruct 1–232； UniProt 1–232 Author chain AO； PDBConstruct 1–232； UniProt 1–232 Author chain AP； PDBConstruct 1–232； UniProt 1–232 Author chain AQ； PDBConstruct 1–232； UniProt 1–232 Author chain AR； PDBConstruct 1–232； UniProt 1–232 Author chain AS； PDBConstruct 1–232； UniProt 1–232 Author chain AT； PDBConstruct 1–232； UniProt 1–232 Author chain AU； PDBConstruct 1–232； UniProt 1–232 Author chain AV； PDBConstruct 1–232； UniProt 1–232 Author chain AW； PDBConstruct 1–232； UniProt 1–232 Author chain AX； PDBConstruct 1–232； UniProt 1–232 Author chain AY； PDBConstruct 1–232； UniProt 1–232 Author chain AZ； PDBConstruct 1–232； UniProt 1–232

Flagellar P-ring protein

OrganismNot specified

UniProt P15930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 219	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 33 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar M-ring protein × 57 （P15928） FlgB-Dc loop × 5 FliE helix 1 × 6 Flagellar L-ring protein × 26 （P0A1N8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGI_SALTY
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain BA； PDBConstruct 1–365； UniProt 1–365 Author chain BB； PDBConstruct 1–365； UniProt 1–365 Author chain BC； PDBConstruct 1–365； UniProt 1–365 Author chain BD； PDBConstruct 1–365； UniProt 1–365 Author chain BE； PDBConstruct 1–365； UniProt 1–365 Author chain BF； PDBConstruct 1–365； UniProt 1–365 Author chain BG； PDBConstruct 1–365； UniProt 1–365 Author chain BH； PDBConstruct 1–365； UniProt 1–365 Author chain BI； PDBConstruct 1–365； UniProt 1–365 Author chain BJ； PDBConstruct 1–365； UniProt 1–365 Author chain BK； PDBConstruct 1–365； UniProt 1–365 Author chain BL； PDBConstruct 1–365； UniProt 1–365 Author chain BM； PDBConstruct 1–365； UniProt 1–365 Author chain BN； PDBConstruct 1–365； UniProt 1–365 Author chain BO； PDBConstruct 1–365； UniProt 1–365 Author chain BP； PDBConstruct 1–365； UniProt 1–365 Author chain BQ； PDBConstruct 1–365； UniProt 1–365 Author chain BR； PDBConstruct 1–365； UniProt 1–365 Author chain BS； PDBConstruct 1–365； UniProt 1–365 Author chain BT； PDBConstruct 1–365； UniProt 1–365 Author chain BU； PDBConstruct 1–365； UniProt 1–365 Author chain BV； PDBConstruct 1–365； UniProt 1–365 Author chain BW； PDBConstruct 1–365； UniProt 1–365 Author chain BX； PDBConstruct 1–365； UniProt 1–365 Author chain BY； PDBConstruct 1–365； UniProt 1–365 Author chain BZ； PDBConstruct 1–365； UniProt 1–365

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7cgo
Deposition date deposition_date	2020-07-01
Structure title title	Cryo-EM structure of the flagellar motor-hook complex from Salmonella
Keywords keywords	Flagella, Hook-basal body, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7cgo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7cgo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7cgo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	137.40 Å
Total Rg	137.20 Å
Atom count	335722
Residues	45082
Excluded volume	5915500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7cgo__assembly_1__model_1`	219-meric （219）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X
Atom count atom_count	335722

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 2 Entity 2 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 3 Entity 3 polymer

Description description	Flagellar MS ring L2
Molecular weight formula_weight	1294.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4

XXXXXXXXXXXXXXX

Entity 4 Entity 4 polymer

Description description	Flagellar MS ring L1
Molecular weight formula_weight	1998.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6,7,9,8

GVPGALSNQPAPPNEAPIATP

Entity 5 Entity 5 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,g,h,j,p,i

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 6 Entity 6 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,m,o,k,n

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 7 Entity 7 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,r,s,t,u,v

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 8 Entity 8 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	33

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DA,DB,DC,DD,DE,DF,DG,DH,DI,DJ,DK,DL,DM,DN,DO,DP,DQ,DR,DS,DT,DU,DV,DW,DX,DY,DZ,EA,EB,EC,ED,EE,EF,EG

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

Entity 9 Entity 9 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CE

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 10 Entity 10 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CA,CB,CC,CD

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 11 Entity 11 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w,x,y,z,CF

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 12 Entity 12 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	57

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;Da,Db,Dc,Dd,De,Df,Dg,Dh,Di,Dj,Dk,Dl,Dm,Dn,Do,Dp,Dq,Dr,Ds,Dt,Du,Dv,Dw,Ca,Cb,Cc,Cd,Ce,Cf,Cg,Ch,Ci,Cj,Ck,Cl,Cm,Cn,Co,Cp,Cq,Cr,Cs,Ct,Cu,Cv,Cw,Cx,Cy,Cz,Ea,Eb,Ec,Ed,Ee,Ef,Eg,Eh ;

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 13 Entity 13 polymer

Description description	FlgB-Dc loop
Molecular weight formula_weight	1039.3 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GA,GC,GE,GD,GB

XXXXXXXXXXXX

Entity 14 Entity 14 polymer

Description description	FliE helix 1
Molecular weight formula_weight	1549.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GF,GG,GH,GI,GJ,GK

XXXXXXXXXXXXXXXXXX

Entity 15 Entity 15 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24965.1 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ,AR,AS,AT,AU,AV,AW,AX,AY,AZ

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 16 Entity 16 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB,BC,BD,BE,BF,BG,BH,BI,BJ,BK,BL,BM,BN,BO,BP,BQ,BR,BS,BT,BU,BV,BW,BX,BY,BZ

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	52714

Cryo-EM structure of the flagellar motor-hook complex from Salmonella

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar MS ring L1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer