SAXSdb — 7bgl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 78	Flagellar P-ring protein × 26 （P15930） YecR × 26 （A0A745A2I3） (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4,5-bis(oxidanyl)oxane-2-carboxylic acid × 26 ;[(3~{R})-1-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-(hydroxymethyl)-5-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]oxymethyl]-5-oxidanyl-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-2-phosphonooxy-oxan-3-yl]amino]-1-oxidanylidene-tetradecan-3-yl] hexadecanoate ; × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGH_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–232； UniProt 1–232 Author chain B； PDBConstruct 1–232； UniProt 1–232 Author chain C； PDBConstruct 1–232； UniProt 1–232 Author chain D； PDBConstruct 1–232； UniProt 1–232 Author chain E； PDBConstruct 1–232； UniProt 1–232 Author chain F； PDBConstruct 1–232； UniProt 1–232 Author chain G； PDBConstruct 1–232； UniProt 1–232 Author chain H； PDBConstruct 1–232； UniProt 1–232 Author chain I； PDBConstruct 1–232； UniProt 1–232 Author chain J； PDBConstruct 1–232； UniProt 1–232 Author chain K； PDBConstruct 1–232； UniProt 1–232 Author chain L； PDBConstruct 1–232； UniProt 1–232 Author chain M； PDBConstruct 1–232； UniProt 1–232 Author chain N； PDBConstruct 1–232； UniProt 1–232 Author chain O； PDBConstruct 1–232； UniProt 1–232 Author chain P； PDBConstruct 1–232； UniProt 1–232 Author chain Q； PDBConstruct 1–232； UniProt 1–232 Author chain R； PDBConstruct 1–232； UniProt 1–232 Author chain S； PDBConstruct 1–232； UniProt 1–232 Author chain T； PDBConstruct 1–232； UniProt 1–232 Author chain U； PDBConstruct 1–232； UniProt 1–232 Author chain V； PDBConstruct 1–232； UniProt 1–232 Author chain W； PDBConstruct 1–232； UniProt 1–232 Author chain X； PDBConstruct 1–232； UniProt 1–232 Author chain Y； PDBConstruct 1–232； UniProt 1–232 Author chain Z； PDBConstruct 1–232； UniProt 1–232

Flagellar P-ring protein

OrganismNot specified

UniProt P15930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 78	Flagellar L-ring protein × 26 （P0A1N8） YecR × 26 （A0A745A2I3） (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4,5-bis(oxidanyl)oxane-2-carboxylic acid × 26 ;[(3~{R})-1-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-(hydroxymethyl)-5-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]oxymethyl]-5-oxidanyl-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-2-phosphonooxy-oxan-3-yl]amino]-1-oxidanylidene-tetradecan-3-yl] hexadecanoate ; × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGI_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–365； UniProt 1–365 Author chain b； PDBConstruct 1–365； UniProt 1–365 Author chain c； PDBConstruct 1–365； UniProt 1–365 Author chain d； PDBConstruct 1–365； UniProt 1–365 Author chain e； PDBConstruct 1–365； UniProt 1–365 Author chain f； PDBConstruct 1–365； UniProt 1–365 Author chain g； PDBConstruct 1–365； UniProt 1–365 Author chain h； PDBConstruct 1–365； UniProt 1–365 Author chain i； PDBConstruct 1–365； UniProt 1–365 Author chain j； PDBConstruct 1–365； UniProt 1–365 Author chain k； PDBConstruct 1–365； UniProt 1–365 Author chain l； PDBConstruct 1–365； UniProt 1–365 Author chain m； PDBConstruct 1–365； UniProt 1–365 Author chain n； PDBConstruct 1–365； UniProt 1–365 Author chain o； PDBConstruct 1–365； UniProt 1–365 Author chain p； PDBConstruct 1–365； UniProt 1–365 Author chain q； PDBConstruct 1–365； UniProt 1–365 Author chain r； PDBConstruct 1–365； UniProt 1–365 Author chain s； PDBConstruct 1–365； UniProt 1–365 Author chain t； PDBConstruct 1–365； UniProt 1–365 Author chain u； PDBConstruct 1–365； UniProt 1–365 Author chain v； PDBConstruct 1–365； UniProt 1–365 Author chain w； PDBConstruct 1–365； UniProt 1–365 Author chain x； PDBConstruct 1–365； UniProt 1–365 Author chain y； PDBConstruct 1–365； UniProt 1–365 Author chain z； PDBConstruct 1–365； UniProt 1–365

YecR

OrganismNot specified

UniProt A0A745A2I3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 78	Flagellar L-ring protein × 26 （P0A1N8） Flagellar P-ring protein × 26 （P15930） (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4,5-bis(oxidanyl)oxane-2-carboxylic acid × 26 ;[(3~{R})-1-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-(hydroxymethyl)-5-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]oxymethyl]-5-oxidanyl-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-2-phosphonooxy-oxan-3-yl]amino]-1-oxidanylidene-tetradecan-3-yl] hexadecanoate ; × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A745A2I3_SALTI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1； PDBConstruct 1–111； UniProt 1–111 Author chain 10； PDBConstruct 1–111； UniProt 1–111 Author chain 11； PDBConstruct 1–111； UniProt 1–111 Author chain 12； PDBConstruct 1–111； UniProt 1–111 Author chain 13； PDBConstruct 1–111； UniProt 1–111 Author chain 14； PDBConstruct 1–111； UniProt 1–111 Author chain 15； PDBConstruct 1–111； UniProt 1–111 Author chain 16； PDBConstruct 1–111； UniProt 1–111 Author chain 17； PDBConstruct 1–111； UniProt 1–111 Author chain 18； PDBConstruct 1–111； UniProt 1–111 Author chain 19； PDBConstruct 1–111； UniProt 1–111 Author chain 2； PDBConstruct 1–111； UniProt 1–111 Author chain 20； PDBConstruct 1–111； UniProt 1–111 Author chain 21； PDBConstruct 1–111； UniProt 1–111 Author chain 22； PDBConstruct 1–111； UniProt 1–111 Author chain 23； PDBConstruct 1–111； UniProt 1–111 Author chain 24； PDBConstruct 1–111； UniProt 1–111 Author chain 25； PDBConstruct 1–111； UniProt 1–111 Author chain 26； PDBConstruct 1–111； UniProt 1–111 Author chain 3； PDBConstruct 1–111； UniProt 1–111 Author chain 4； PDBConstruct 1–111； UniProt 1–111 Author chain 5； PDBConstruct 1–111； UniProt 1–111 Author chain 6； PDBConstruct 1–111； UniProt 1–111 Author chain 7； PDBConstruct 1–111； UniProt 1–111 Author chain 8； PDBConstruct 1–111； UniProt 1–111 Author chain 9； PDBConstruct 1–111； UniProt 1–111

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bgl
Deposition date deposition_date	2021-01-07
Structure title title	Salmonella LP ring 26 mer refined in C26 map
Keywords keywords	bacterial flagellum LP ring salmonella, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bgl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bgl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bgl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	97.01 Å
Rg (electron density)	95.97 Å
Total Rg	96.04 Å
Atom count	126022
Residues	15626
Excluded volume	2142300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bgl__assembly_1__model_1`	78-meric （78）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24726.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z
Atom count atom_count	126022

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 2 Entity 2 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

Entity 3 Entity 3 polymer

Description description	YecR
Molecular weight formula_weight	12195.0 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26

MKSLIFTLSLLALTGCTITRQAQVSEASPISGIVRLTYNQPLFFTSRTDDYVSHGTATRECQQMGYADAVSFGQPVGTCSIYAGSLCLNTRFTLSWQCRGVAVPQIMPLYY

Entity 4 Entity 4 non-polymer

Description description	(2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4,5-bis(oxidanyl)oxane-2-carboxylic acid
Molecular weight formula_weight	222.2 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 5 Entity 5 non-polymer

Description description	;[(3~{R})-1-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-(hydroxymethyl)-5-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]oxymethyl]-5-oxidanyl-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-2-phosphonooxy-oxan-3-yl]amino]-1-oxidanylidene-tetradecan-3-yl] hexadecanoate ;
Molecular weight formula_weight	2036.8 kDa
Source method src_method	syn
Copy count entity_count	26

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	31643

Salmonella LP ring 26 mer refined in C26 map

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

YecR

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bgl__assembly_1__model_1

7bgl__assembly_1__model_1 | I(q)

7bgl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)

Salmonella LP ring 26 mer refined in C26 map

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

YecR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bgl__assembly_1__model_1

7bgl__assembly_1__model_1 | I(q)

7bgl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)