SAXSdb — 8wle

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 52 PDB declaration: 52-meric（52） Consistent with protein copy count	Chain A； UniProt 1–232 Chain B； UniProt 1–232 Chain C； UniProt 1–232 Chain D； UniProt 1–232 Chain E； UniProt 1–232 Chain F； UniProt 1–232 Chain G； UniProt 1–232 Chain H； UniProt 1–232 Chain I； UniProt 1–232 Chain J； UniProt 1–232 Chain K； UniProt 1–232 Chain L； UniProt 1–232 Chain M； UniProt 1–232 Chain N； UniProt 1–232 Chain O； UniProt 1–232 Chain P； UniProt 1–232 Chain Q； UniProt 1–232 Chain R； UniProt 1–232 Chain S； UniProt 1–232 Chain T； UniProt 1–232 Chain U； UniProt 1–232 Chain V； UniProt 1–232 Chain W； UniProt 1–232 Chain X； UniProt 1–232 Chain Y； UniProt 1–232 Chain Z； UniProt 1–232	Not recorded	Flagellar P-ring protein × 26 （P15930）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8WLE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BGL Salmonella LP ring 26 mer refined in C26 map Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 78 PDB declaration: 78-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	TLW (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4,5-bis(oxidanyl)oxane-2-carboxylic acid × 26 TQN [(3~{R})-1-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-(hydroxymethyl)-5-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]oxymethyl]-5-oxidanyl-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-2-phosphonooxy-oxan-3-yl]amino]-1-oxidanylidene-tetradecan-3-yl] hexadecanoate × 26	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7CBL Cryo-EM structure of the flagellar LP ring from Salmonella Deposited 2020-06-12	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 52 PDB declaration: 52-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	OCA OCTANOIC ACID (CAPRYLIC ACID) × 26	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 2.80 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain AA 1–232（232 aa） Chain AB 1–232（232 aa） Chain AC 1–232（232 aa） Chain AD 1–232（232 aa） Chain AE 1–232（232 aa） Chain AF 1–232（232 aa） Chain AG 1–232（232 aa） Chain AH 1–232（232 aa） Chain AI 1–232（232 aa） Chain AJ 1–232（232 aa） Chain AK 1–232（232 aa） Chain AL 1–232（232 aa） Chain AM 1–232（232 aa） Chain AN 1–232（232 aa） Chain AO 1–232（232 aa） Chain AP 1–232（232 aa） Chain AQ 1–232（232 aa） Chain AR 1–232（232 aa） Chain AS 1–232（232 aa） Chain AT 1–232（232 aa） Chain AU 1–232（232 aa） Chain AV 1–232（232 aa） Chain AW 1–232（232 aa） Chain AX 1–232（232 aa） Chain AY 1–232（232 aa） Chain AZ 1–232（232 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
8WHT Cryo-EM structure of the LP ring within the flagellar motor-hook complex in the CW state Deposited 2023-09-23	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 52 PDB declaration: 52-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 2.75 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain A 1–232（232 aa） Chain B 1–232（232 aa） Chain C 1–232（232 aa） Chain D 1–232（232 aa） Chain E 1–232（232 aa） Chain F 1–232（232 aa） Chain G 1–232（232 aa） Chain H 1–232（232 aa） Chain I 1–232（232 aa） Chain J 1–232（232 aa） Chain K 1–232（232 aa） Chain L 1–232（232 aa） Chain M 1–232（232 aa） Chain N 1–232（232 aa） Chain O 1–232（232 aa） Chain P 1–232（232 aa） Chain Q 1–232（232 aa） Chain R 1–232（232 aa） Chain S 1–232（232 aa） Chain T 1–232（232 aa） Chain U 1–232（232 aa） Chain V 1–232（232 aa） Chain W 1–232（232 aa） Chain X 1–232（232 aa） Chain Y 1–232（232 aa） Chain Z 1–232（232 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGH_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–232； UniProt 1–232 Author chain B； PDBConstruct 1–232； UniProt 1–232 Author chain C； PDBConstruct 1–232； UniProt 1–232 Author chain D； PDBConstruct 1–232； UniProt 1–232 Author chain E； PDBConstruct 1–232； UniProt 1–232 Author chain F； PDBConstruct 1–232； UniProt 1–232 Author chain G； PDBConstruct 1–232； UniProt 1–232 Author chain H； PDBConstruct 1–232； UniProt 1–232 Author chain I； PDBConstruct 1–232； UniProt 1–232 Author chain J； PDBConstruct 1–232； UniProt 1–232 Author chain K； PDBConstruct 1–232； UniProt 1–232 Author chain L； PDBConstruct 1–232； UniProt 1–232 Author chain M； PDBConstruct 1–232； UniProt 1–232 Author chain N； PDBConstruct 1–232； UniProt 1–232 Author chain O； PDBConstruct 1–232； UniProt 1–232 Author chain P； PDBConstruct 1–232； UniProt 1–232 Author chain Q； PDBConstruct 1–232； UniProt 1–232 Author chain R； PDBConstruct 1–232； UniProt 1–232 Author chain S； PDBConstruct 1–232； UniProt 1–232 Author chain T； PDBConstruct 1–232； UniProt 1–232 Author chain U； PDBConstruct 1–232； UniProt 1–232 Author chain V； PDBConstruct 1–232； UniProt 1–232 Author chain W； PDBConstruct 1–232； UniProt 1–232 Author chain X； PDBConstruct 1–232； UniProt 1–232 Author chain Y； PDBConstruct 1–232； UniProt 1–232 Author chain Z； PDBConstruct 1–232； UniProt 1–232

Flagellar P-ring protein

OrganismNot specified

UniProt P15930

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 52 PDB declaration: 52-meric（52） Consistent with protein copy count	Chain a； UniProt 1–365 Chain b； UniProt 1–365 Chain c； UniProt 1–365 Chain d； UniProt 1–365 Chain e； UniProt 1–365 Chain f； UniProt 1–365 Chain g； UniProt 1–365 Chain h； UniProt 1–365 Chain i； UniProt 1–365 Chain j； UniProt 1–365 Chain k； UniProt 1–365 Chain l； UniProt 1–365 Chain m； UniProt 1–365 Chain n； UniProt 1–365 Chain o； UniProt 1–365 Chain p； UniProt 1–365 Chain q； UniProt 1–365 Chain r； UniProt 1–365 Chain s； UniProt 1–365 Chain t； UniProt 1–365 Chain u； UniProt 1–365 Chain v； UniProt 1–365 Chain w； UniProt 1–365 Chain x； UniProt 1–365 Chain y； UniProt 1–365 Chain z； UniProt 1–365	Not recorded	Flagellar L-ring protein × 26 （P0A1N8）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8WLE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BGL Salmonella LP ring 26 mer refined in C26 map Deposited 2021-01-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 78 PDB declaration: 78-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	TLW (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4,5-bis(oxidanyl)oxane-2-carboxylic acid × 26 TQN [(3~{R})-1-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-6-[[(2~{R},3~{R},4~{R},5~{S},6~{R})-3-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-(hydroxymethyl)-5-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]oxymethyl]-5-oxidanyl-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-2-phosphonooxy-oxan-3-yl]amino]-1-oxidanylidene-tetradecan-3-yl] hexadecanoate × 26	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7BJ2 Salmonella flagellar basal body assembly intermediate - P ring alone structure Deposited 2021-01-13	Different oligomeric state Different experimental conditions	Assembly 1 Protein homooligomer Homooligomer；Protein × 26 PDB declaration: 26-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7CBL Cryo-EM structure of the flagellar LP ring from Salmonella Deposited 2020-06-12	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 52 PDB declaration: 52-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	OCA OCTANOIC ACID (CAPRYLIC ACID) × 26	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 2.80 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain BA 1–365（365 aa） Chain BB 1–365（365 aa） Chain BC 1–365（365 aa） Chain BD 1–365（365 aa） Chain BE 1–365（365 aa） Chain BF 1–365（365 aa） Chain BG 1–365（365 aa） Chain BH 1–365（365 aa） Chain BI 1–365（365 aa） Chain BJ 1–365（365 aa） Chain BK 1–365（365 aa） Chain BL 1–365（365 aa） Chain BM 1–365（365 aa） Chain BN 1–365（365 aa） Chain BO 1–365（365 aa） Chain BP 1–365（365 aa） Chain BQ 1–365（365 aa） Chain BR 1–365（365 aa） Chain BS 1–365（365 aa） Chain BT 1–365（365 aa） Chain BU 1–365（365 aa） Chain BV 1–365（365 aa） Chain BW 1–365（365 aa） Chain BX 1–365（365 aa） Chain BY 1–365（365 aa） Chain BZ 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
8WHT Cryo-EM structure of the LP ring within the flagellar motor-hook complex in the CW state Deposited 2023-09-23	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 52 PDB declaration: 52-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 2.75 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain a 1–365（365 aa） Chain b 1–365（365 aa） Chain c 1–365（365 aa） Chain d 1–365（365 aa） Chain e 1–365（365 aa） Chain f 1–365（365 aa） Chain g 1–365（365 aa） Chain h 1–365（365 aa） Chain i 1–365（365 aa） Chain j 1–365（365 aa） Chain k 1–365（365 aa） Chain l 1–365（365 aa） Chain m 1–365（365 aa） Chain n 1–365（365 aa） Chain o 1–365（365 aa） Chain p 1–365（365 aa） Chain q 1–365（365 aa） Chain r 1–365（365 aa） Chain s 1–365（365 aa） Chain t 1–365（365 aa） Chain u 1–365（365 aa） Chain v 1–365（365 aa） Chain w 1–365（365 aa） Chain x 1–365（365 aa） Chain y 1–365（365 aa） Chain z 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9IYC P ring on polyrod-P ring complex from Salmonella TH26292 strain Deposited 2024-07-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 26 PDB declaration: 26-meric	Chain A 20–365（346 aa） Chain B 20–365（346 aa） Chain C 20–365（346 aa） Chain D 20–365（346 aa） Chain E 20–365（346 aa） Chain F 20–365（346 aa） Chain G 20–365（346 aa） Chain H 20–365（346 aa） Chain I 20–365（346 aa） Chain J 20–365（346 aa） Chain K 20–365（346 aa） Chain L 20–365（346 aa） Chain M 20–365（346 aa） Chain N 20–365（346 aa） Chain O 20–365（346 aa） Chain P 20–365（346 aa） Chain Q 20–365（346 aa） Chain R 20–365（346 aa） Chain S 20–365（346 aa） Chain T 20–365（346 aa） Chain U 20–365（346 aa） Chain V 20–365（346 aa） Chain W 20–365（346 aa） Chain X 20–365（346 aa） Chain Y 20–365（346 aa） Chain Z 20–365（346 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；BLOTTING TIME OF 4 SECONDS, 1 SECONDS DRAIN TIME, FORCE 0	Resolution 2.33 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGI_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–365； UniProt 1–365 Author chain b； PDBConstruct 1–365； UniProt 1–365 Author chain c； PDBConstruct 1–365； UniProt 1–365 Author chain d； PDBConstruct 1–365； UniProt 1–365 Author chain e； PDBConstruct 1–365； UniProt 1–365 Author chain f； PDBConstruct 1–365； UniProt 1–365 Author chain g； PDBConstruct 1–365； UniProt 1–365 Author chain h； PDBConstruct 1–365； UniProt 1–365 Author chain i； PDBConstruct 1–365； UniProt 1–365 Author chain j； PDBConstruct 1–365； UniProt 1–365 Author chain k； PDBConstruct 1–365； UniProt 1–365 Author chain l； PDBConstruct 1–365； UniProt 1–365 Author chain m； PDBConstruct 1–365； UniProt 1–365 Author chain n； PDBConstruct 1–365； UniProt 1–365 Author chain o； PDBConstruct 1–365； UniProt 1–365 Author chain p； PDBConstruct 1–365； UniProt 1–365 Author chain q； PDBConstruct 1–365； UniProt 1–365 Author chain r； PDBConstruct 1–365； UniProt 1–365 Author chain s； PDBConstruct 1–365； UniProt 1–365 Author chain t； PDBConstruct 1–365； UniProt 1–365 Author chain u； PDBConstruct 1–365； UniProt 1–365 Author chain v； PDBConstruct 1–365； UniProt 1–365 Author chain w； PDBConstruct 1–365； UniProt 1–365 Author chain x； PDBConstruct 1–365； UniProt 1–365 Author chain y； PDBConstruct 1–365； UniProt 1–365 Author chain z； PDBConstruct 1–365； UniProt 1–365

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wle
Deposition date deposition_date	2023-09-29
Structure title title	Cryo-EM structure of the LP ring within the flagellar motor-hook complex in the CCW state.
Keywords keywords	Flagellum, Flagellar motor, LP ring, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	94.56 Å
Radius of gyration Rg (electron density) rg_electron	93.50 Å
Forward intensity I(0) i0	29436500000.00
Molecular weight molecular_weight	1411800.0 kDa
Excluded volume excluded_volume	1747900 Å³
Envelope volume envelope_volume	3229300 Å³
Hydration-shell volume shell_volume	279380 Å³
Envelope diameter envelope_diameter	254.4 Å
Shell Rg shell_rg	108.10 Å
Envelope Rg envelope_rg	84.05 Å
Shape Rg shape_rg	93.54 Å
Total Rg total_rg	93.46 Å
Total atoms total_atoms	99008
Residues n_residues	13364
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	241.4 Å
Rg (real space) rg_real	93.59 Å
Rg uncertainty (real space) rg_real_error	0.74 Å
I(0) (real space) i0_real	2.9400e+10
I(0) uncertainty (real space) i0_real_error	5.3730e+08
Rg (reciprocal space) rg_reciprocal	97.27 Å
I(0) (reciprocal space) i0_reciprocal	29700000000.0000
Solution quality estimate total_estimate	0.5915
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	150.9 Å
Skewness Skewness skewness	-0.279
Kurtosis Kurtosis kurtosis	-0.868
Angular range angular_range	— – 0.0800 Å⁻¹
Current regularization parameter α current_alpha	0.0494
Highest regularization parameter α highest_alpha	844500000.0000
Real-space data points n_real_points	17
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.914; Stabil: 0.999; Sysdev: 0.000; Positv: 1.000; Valcen: 0.945; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24726.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z
Atom count atom_count	99008

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 2 Entity 2 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	11858

fit	/app/data/saxs_computation/wl/8wle/8wle.fit
pddf	/app/data/pr_computation/wl/8wle/8wle.pr.out
profile	/app/data/saxs_computation/wl/8wle/8wle.dat

Cryo-EM structure of the LP ring within the flagellar motor-hook complex in the CCW state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar P-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)