8woe

Cryo-EM structure of the intact flagellar motor-hook complex in the CW state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGG_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–260； UniProt 1–260 Author chain 1； PDBConstruct 1–260； UniProt 1–260 Author chain 2； PDBConstruct 1–260； UniProt 1–260 Author chain 3； PDBConstruct 1–260； UniProt 1–260 Author chain 4； PDBConstruct 1–260； UniProt 1–260 Author chain 5； PDBConstruct 1–260； UniProt 1–260 Author chain 6； PDBConstruct 1–260； UniProt 1–260 Author chain 7； PDBConstruct 1–260； UniProt 1–260 Author chain 8； PDBConstruct 1–260； UniProt 1–260 Author chain 9； PDBConstruct 1–260； UniProt 1–260 Author chain AF； PDBConstruct 1–260； UniProt 1–260 Author chain AG； PDBConstruct 1–260； UniProt 1–260 Author chain AH； PDBConstruct 1–260； UniProt 1–260 Author chain AI； PDBConstruct 1–260； UniProt 1–260 Author chain AJ； PDBConstruct 1–260； UniProt 1–260 Author chain AK； PDBConstruct 1–260； UniProt 1–260 Author chain AL； PDBConstruct 1–260； UniProt 1–260 Author chain AM； PDBConstruct 1–260； UniProt 1–260 Author chain AN； PDBConstruct 1–260； UniProt 1–260 Author chain ZA； PDBConstruct 1–260； UniProt 1–260 Author chain ZB； PDBConstruct 1–260； UniProt 1–260 Author chain ZC； PDBConstruct 1–260； UniProt 1–260 Author chain ZD； PDBConstruct 1–260； UniProt 1–260 Author chain ZE； PDBConstruct 1–260； UniProt 1–260

Flagellar L-ring protein

OrganismNot specified

UniProt P0A1N8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGH_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–232； UniProt 1–232 Author chain B； PDBConstruct 1–232； UniProt 1–232 Author chain C； PDBConstruct 1–232； UniProt 1–232 Author chain D； PDBConstruct 1–232； UniProt 1–232 Author chain E； PDBConstruct 1–232； UniProt 1–232 Author chain F； PDBConstruct 1–232； UniProt 1–232 Author chain G； PDBConstruct 1–232； UniProt 1–232 Author chain H； PDBConstruct 1–232； UniProt 1–232 Author chain I； PDBConstruct 1–232； UniProt 1–232 Author chain J； PDBConstruct 1–232； UniProt 1–232 Author chain K； PDBConstruct 1–232； UniProt 1–232 Author chain L； PDBConstruct 1–232； UniProt 1–232 Author chain M； PDBConstruct 1–232； UniProt 1–232 Author chain N； PDBConstruct 1–232； UniProt 1–232 Author chain O； PDBConstruct 1–232； UniProt 1–232 Author chain P； PDBConstruct 1–232； UniProt 1–232 Author chain Q； PDBConstruct 1–232； UniProt 1–232 Author chain R； PDBConstruct 1–232； UniProt 1–232 Author chain S； PDBConstruct 1–232； UniProt 1–232 Author chain T； PDBConstruct 1–232； UniProt 1–232 Author chain U； PDBConstruct 1–232； UniProt 1–232 Author chain V； PDBConstruct 1–232； UniProt 1–232 Author chain W； PDBConstruct 1–232； UniProt 1–232 Author chain X； PDBConstruct 1–232； UniProt 1–232 Author chain Y； PDBConstruct 1–232； UniProt 1–232 Author chain Z； PDBConstruct 1–232； UniProt 1–232

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A0； PDBConstruct 1–138； UniProt 1–138 Author chain A6； PDBConstruct 1–138； UniProt 1–138 Author chain A7； PDBConstruct 1–138； UniProt 1–138 Author chain A8； PDBConstruct 1–138； UniProt 1–138 Author chain A9； PDBConstruct 1–138； UniProt 1–138

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A1； PDBConstruct 1–104； UniProt 1–104 Author chain A2； PDBConstruct 1–104； UniProt 1–104 Author chain A3； PDBConstruct 1–104； UniProt 1–104 Author chain A4； PDBConstruct 1–104； UniProt 1–104 Author chain A5； PDBConstruct 1–104； UniProt 1–104 Author chain Az； PDBConstruct 1–104； UniProt 1–104

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt P16323

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGF_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AA； PDBConstruct 1–251； UniProt 1–251 Author chain AB； PDBConstruct 1–251； UniProt 1–251 Author chain AC； PDBConstruct 1–251； UniProt 1–251 Author chain AD； PDBConstruct 1–251； UniProt 1–251 Author chain AE； PDBConstruct 1–251； UniProt 1–251

Flagellar M-ring protein

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AO； PDBConstruct 1–560； UniProt 1–560 Author chain AP； PDBConstruct 1–560； UniProt 1–560 Author chain AQ； PDBConstruct 1–560； UniProt 1–560 Author chain AR； PDBConstruct 1–560； UniProt 1–560 Author chain AS； PDBConstruct 1–560； UniProt 1–560 Author chain AT； PDBConstruct 1–560； UniProt 1–560 Author chain AU； PDBConstruct 1–560； UniProt 1–560 Author chain AV； PDBConstruct 1–560； UniProt 1–560 Author chain AW； PDBConstruct 1–560； UniProt 1–560 Author chain AX； PDBConstruct 1–560； UniProt 1–560 Author chain AY； PDBConstruct 1–560； UniProt 1–560 Author chain AZ； PDBConstruct 1–560； UniProt 1–560 Author chain Aa； PDBConstruct 1–560； UniProt 1–560 Author chain Ac； PDBConstruct 1–560； UniProt 1–560 Author chain Ad； PDBConstruct 1–560； UniProt 1–560 Author chain Ae； PDBConstruct 1–560； UniProt 1–560 Author chain Af； PDBConstruct 1–560； UniProt 1–560 Author chain Ag； PDBConstruct 1–560； UniProt 1–560 Author chain Ah； PDBConstruct 1–560； UniProt 1–560 Author chain Ai； PDBConstruct 1–560； UniProt 1–560 Author chain Aj； PDBConstruct 1–560； UniProt 1–560 Author chain Ak； PDBConstruct 1–560； UniProt 1–560 Author chain Al； PDBConstruct 1–560； UniProt 1–560 Author chain Am； PDBConstruct 1–560； UniProt 1–560 Author chain An； PDBConstruct 1–560； UniProt 1–560 Author chain Ao； PDBConstruct 1–560； UniProt 1–560 Author chain Ap； PDBConstruct 1–560； UniProt 1–560 Author chain B0； PDBConstruct 1–560； UniProt 1–560 Author chain B3； PDBConstruct 1–560； UniProt 1–560 Author chain BG； PDBConstruct 1–560； UniProt 1–560 Author chain BH； PDBConstruct 1–560； UniProt 1–560 Author chain BI； PDBConstruct 1–560； UniProt 1–560 Author chain BJ； PDBConstruct 1–560； UniProt 1–560 Author chain BK； PDBConstruct 1–560； UniProt 1–560 Author chain BL； PDBConstruct 1–560； UniProt 1–560 Author chain BM； PDBConstruct 1–560； UniProt 1–560 Author chain BN； PDBConstruct 1–560； UniProt 1–560 Author chain BO； PDBConstruct 1–560； UniProt 1–560 Author chain BP； PDBConstruct 1–560； UniProt 1–560 Author chain BQ； PDBConstruct 1–560； UniProt 1–560 Author chain BR； PDBConstruct 1–560； UniProt 1–560 Author chain BS； PDBConstruct 1–560； UniProt 1–560 Author chain BT； PDBConstruct 1–560； UniProt 1–560 Author chain BU； PDBConstruct 1–560； UniProt 1–560 Author chain BV； PDBConstruct 1–560； UniProt 1–560 Author chain BW； PDBConstruct 1–560； UniProt 1–560 Author chain BX； PDBConstruct 1–560； UniProt 1–560 Author chain Ba； PDBConstruct 1–560； UniProt 1–560 Author chain Bh； PDBConstruct 1–560； UniProt 1–560 Author chain Bo； PDBConstruct 1–560； UniProt 1–560 Author chain Bv； PDBConstruct 1–560； UniProt 1–560 Author chain CG； PDBConstruct 1–560； UniProt 1–560 Author chain CN； PDBConstruct 1–560； UniProt 1–560 Author chain CU； PDBConstruct 1–560； UniProt 1–560 Author chain Cb； PDBConstruct 1–560； UniProt 1–560 Author chain Ci； PDBConstruct 1–560； UniProt 1–560 Author chain Cp； PDBConstruct 1–560； UniProt 1–560 Author chain Cw； PDBConstruct 1–560； UniProt 1–560 Author chain DE； PDBConstruct 1–560； UniProt 1–560 Author chain DL； PDBConstruct 1–560； UniProt 1–560 Author chain EH； PDBConstruct 1–560； UniProt 1–560 Author chain EO； PDBConstruct 1–560； UniProt 1–560 Author chain EV； PDBConstruct 1–560； UniProt 1–560 Author chain Ea； PDBConstruct 1–560； UniProt 1–560 Author chain Eb； PDBConstruct 1–560； UniProt 1–560 Author chain Ec； PDBConstruct 1–560； UniProt 1–560 Author chain Ed； PDBConstruct 1–560； UniProt 1–560 Author chain Ee； PDBConstruct 1–560； UniProt 1–560 Author chain Ef； PDBConstruct 1–560； UniProt 1–560 Author chain Eg； PDBConstruct 1–560； UniProt 1–560 Author chain Eh； PDBConstruct 1–560； UniProt 1–560 Author chain Ei； PDBConstruct 1–560； UniProt 1–560 Author chain Ej； PDBConstruct 1–560； UniProt 1–560 Author chain Ek； PDBConstruct 1–560； UniProt 1–560 Author chain El； PDBConstruct 1–560； UniProt 1–560 Author chain Em； PDBConstruct 1–560； UniProt 1–560 Author chain En； PDBConstruct 1–560； UniProt 1–560 Author chain Eo； PDBConstruct 1–560； UniProt 1–560 Author chain Ep； PDBConstruct 1–560； UniProt 1–560 Author chain UI； PDBConstruct 1–560； UniProt 1–560 Author chain UJ； PDBConstruct 1–560； UniProt 1–560 Author chain UK； PDBConstruct 1–560； UniProt 1–560 Author chain UL； PDBConstruct 1–560； UniProt 1–560 Author chain UM； PDBConstruct 1–560； UniProt 1–560 Author chain UN； PDBConstruct 1–560； UniProt 1–560 Author chain UO； PDBConstruct 1–560； UniProt 1–560 Author chain UP； PDBConstruct 1–560； UniProt 1–560 Author chain WA； PDBConstruct 1–560； UniProt 1–560 Author chain WB； PDBConstruct 1–560； UniProt 1–560 Author chain WC； PDBConstruct 1–560； UniProt 1–560 Author chain WD； PDBConstruct 1–560； UniProt 1–560 Author chain WE； PDBConstruct 1–560； UniProt 1–560 Author chain WF； PDBConstruct 1–560； UniProt 1–560 Author chain WG； PDBConstruct 1–560； UniProt 1–560 Author chain WH； PDBConstruct 1–560； UniProt 1–560 Author chain WI； PDBConstruct 1–560； UniProt 1–560 Author chain WJ； PDBConstruct 1–560； UniProt 1–560 Author chain WK； PDBConstruct 1–560； UniProt 1–560 Author chain WL； PDBConstruct 1–560； UniProt 1–560 Author chain WM； PDBConstruct 1–560； UniProt 1–560 Author chain WN； PDBConstruct 1–560； UniProt 1–560 Author chain WO； PDBConstruct 1–560； UniProt 1–560 Author chain WP； PDBConstruct 1–560； UniProt 1–560 Author chain WQ； PDBConstruct 1–560； UniProt 1–560 Author chain WR； PDBConstruct 1–560； UniProt 1–560 Author chain WS； PDBConstruct 1–560； UniProt 1–560 Author chain WT； PDBConstruct 1–560； UniProt 1–560 Author chain WU； PDBConstruct 1–560； UniProt 1–560 Author chain WV； PDBConstruct 1–560； UniProt 1–560 Author chain WW； PDBConstruct 1–560； UniProt 1–560

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–89； UniProt 1–89 Author chain Aq； PDBConstruct 1–89； UniProt 1–89 Author chain Ar； PDBConstruct 1–89； UniProt 1–89 Author chain As； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain At； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Au； PDBConstruct 1–245； UniProt 1–245 Author chain Av； PDBConstruct 1–245； UniProt 1–245 Author chain Aw； PDBConstruct 1–245； UniProt 1–245 Author chain Ax； PDBConstruct 1–245； UniProt 1–245 Author chain Ay； PDBConstruct 1–245； UniProt 1–245

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain BA； PDBConstruct 1–134； UniProt 1–134 Author chain BB； PDBConstruct 1–134； UniProt 1–134 Author chain BC； PDBConstruct 1–134； UniProt 1–134 Author chain BD； PDBConstruct 1–134； UniProt 1–134 Author chain BE； PDBConstruct 1–134； UniProt 1–134 Author chain BF； PDBConstruct 1–134； UniProt 1–134

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain ZF； PDBConstruct 1–403； UniProt 1–403 Author chain ZG； PDBConstruct 1–403； UniProt 1–403 Author chain ZH； PDBConstruct 1–403； UniProt 1–403 Author chain ZI； PDBConstruct 1–403； UniProt 1–403 Author chain ZJ； PDBConstruct 1–403； UniProt 1–403 Author chain ZK； PDBConstruct 1–403； UniProt 1–403 Author chain ZL； PDBConstruct 1–403； UniProt 1–403 Author chain ZM； PDBConstruct 1–403； UniProt 1–403 Author chain ZN； PDBConstruct 1–403； UniProt 1–403 Author chain ZO； PDBConstruct 1–403； UniProt 1–403 Author chain ZP； PDBConstruct 1–403； UniProt 1–403 Author chain ZQ； PDBConstruct 1–403； UniProt 1–403 Author chain ZR； PDBConstruct 1–403； UniProt 1–403 Author chain ZS； PDBConstruct 1–403； UniProt 1–403 Author chain ZT； PDBConstruct 1–403； UniProt 1–403 Author chain ZU； PDBConstruct 1–403； UniProt 1–403 Author chain ZV； PDBConstruct 1–403； UniProt 1–403 Author chain ZW； PDBConstruct 1–403； UniProt 1–403 Author chain ZX； PDBConstruct 1–403； UniProt 1–403 Author chain ZY； PDBConstruct 1–403； UniProt 1–403 Author chain ZZ； PDBConstruct 1–403； UniProt 1–403 Author chain Za； PDBConstruct 1–403； UniProt 1–403 Author chain Zb； PDBConstruct 1–403； UniProt 1–403 Author chain Zc； PDBConstruct 1–403； UniProt 1–403 Author chain Zd； PDBConstruct 1–403； UniProt 1–403 Author chain Ze； PDBConstruct 1–403； UniProt 1–403 Author chain Zf； PDBConstruct 1–403； UniProt 1–403 Author chain Zg； PDBConstruct 1–403； UniProt 1–403 Author chain Zh； PDBConstruct 1–403； UniProt 1–403

Flagellar P-ring protein

OrganismNot specified

UniProt P15930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGI_SALTY
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain a； PDBConstruct 1–365； UniProt 1–365 Author chain b； PDBConstruct 1–365； UniProt 1–365 Author chain c； PDBConstruct 1–365； UniProt 1–365 Author chain d； PDBConstruct 1–365； UniProt 1–365 Author chain e； PDBConstruct 1–365； UniProt 1–365 Author chain f； PDBConstruct 1–365； UniProt 1–365 Author chain g； PDBConstruct 1–365； UniProt 1–365 Author chain h； PDBConstruct 1–365； UniProt 1–365 Author chain i； PDBConstruct 1–365； UniProt 1–365 Author chain j； PDBConstruct 1–365； UniProt 1–365 Author chain k； PDBConstruct 1–365； UniProt 1–365 Author chain l； PDBConstruct 1–365； UniProt 1–365 Author chain m； PDBConstruct 1–365； UniProt 1–365 Author chain n； PDBConstruct 1–365； UniProt 1–365 Author chain o； PDBConstruct 1–365； UniProt 1–365 Author chain p； PDBConstruct 1–365； UniProt 1–365 Author chain q； PDBConstruct 1–365； UniProt 1–365 Author chain r； PDBConstruct 1–365； UniProt 1–365 Author chain s； PDBConstruct 1–365； UniProt 1–365 Author chain t； PDBConstruct 1–365； UniProt 1–365 Author chain u； PDBConstruct 1–365； UniProt 1–365 Author chain v； PDBConstruct 1–365； UniProt 1–365 Author chain w； PDBConstruct 1–365； UniProt 1–365 Author chain x； PDBConstruct 1–365； UniProt 1–365 Author chain y； PDBConstruct 1–365； UniProt 1–365 Author chain z； PDBConstruct 1–365； UniProt 1–365

Flagellar motor switch protein FliN

OrganismNot specified

UniProt P26419

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIN_SALTY
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain B1； PDBConstruct 1–137； UniProt 1–137 Author chain B2； PDBConstruct 1–137； UniProt 1–137 Author chain B7； PDBConstruct 1–137； UniProt 1–137 Author chain B8； PDBConstruct 1–137； UniProt 1–137 Author chain B9； PDBConstruct 1–137； UniProt 1–137 Author chain BY； PDBConstruct 1–137； UniProt 1–137 Author chain BZ； PDBConstruct 1–137； UniProt 1–137 Author chain Be； PDBConstruct 1–137； UniProt 1–137 Author chain Bf； PDBConstruct 1–137； UniProt 1–137 Author chain Bg； PDBConstruct 1–137； UniProt 1–137 Author chain Bl； PDBConstruct 1–137； UniProt 1–137 Author chain Bm； PDBConstruct 1–137； UniProt 1–137 Author chain Bn； PDBConstruct 1–137； UniProt 1–137 Author chain Bs； PDBConstruct 1–137； UniProt 1–137 Author chain Bt； PDBConstruct 1–137； UniProt 1–137 Author chain Bu； PDBConstruct 1–137； UniProt 1–137 Author chain Bz； PDBConstruct 1–137； UniProt 1–137 Author chain C1； PDBConstruct 1–137； UniProt 1–137 Author chain C2； PDBConstruct 1–137； UniProt 1–137 Author chain C3； PDBConstruct 1–137； UniProt 1–137 Author chain C4； PDBConstruct 1–137； UniProt 1–137 Author chain C5； PDBConstruct 1–137； UniProt 1–137 Author chain C8； PDBConstruct 1–137； UniProt 1–137 Author chain C9； PDBConstruct 1–137； UniProt 1–137 Author chain CD； PDBConstruct 1–137； UniProt 1–137 Author chain CE； PDBConstruct 1–137； UniProt 1–137 Author chain CF； PDBConstruct 1–137； UniProt 1–137 Author chain CK； PDBConstruct 1–137； UniProt 1–137 Author chain CL； PDBConstruct 1–137； UniProt 1–137 Author chain CM； PDBConstruct 1–137； UniProt 1–137 Author chain CR； PDBConstruct 1–137； UniProt 1–137 Author chain CS； PDBConstruct 1–137； UniProt 1–137 Author chain CT； PDBConstruct 1–137； UniProt 1–137 Author chain CY； PDBConstruct 1–137； UniProt 1–137 Author chain CZ； PDBConstruct 1–137； UniProt 1–137 Author chain Ca； PDBConstruct 1–137； UniProt 1–137 Author chain Cf； PDBConstruct 1–137； UniProt 1–137 Author chain Cg； PDBConstruct 1–137； UniProt 1–137 Author chain Ch； PDBConstruct 1–137； UniProt 1–137 Author chain Cm； PDBConstruct 1–137； UniProt 1–137 Author chain Cn； PDBConstruct 1–137； UniProt 1–137 Author chain Co； PDBConstruct 1–137； UniProt 1–137 Author chain Ct； PDBConstruct 1–137； UniProt 1–137 Author chain Cu； PDBConstruct 1–137； UniProt 1–137 Author chain Cv； PDBConstruct 1–137； UniProt 1–137 Author chain D1； PDBConstruct 1–137； UniProt 1–137 Author chain D5； PDBConstruct 1–137； UniProt 1–137 Author chain D6； PDBConstruct 1–137； UniProt 1–137 Author chain D7； PDBConstruct 1–137； UniProt 1–137 Author chain DD； PDBConstruct 1–137； UniProt 1–137 Author chain DI； PDBConstruct 1–137； UniProt 1–137 Author chain DJ； PDBConstruct 1–137； UniProt 1–137 Author chain DK； PDBConstruct 1–137； UniProt 1–137 Author chain DM； PDBConstruct 1–137； UniProt 1–137 Author chain DN； PDBConstruct 1–137； UniProt 1–137 Author chain DO； PDBConstruct 1–137； UniProt 1–137 Author chain DP； PDBConstruct 1–137； UniProt 1–137 Author chain DQ； PDBConstruct 1–137； UniProt 1–137 Author chain DR； PDBConstruct 1–137； UniProt 1–137 Author chain DS； PDBConstruct 1–137； UniProt 1–137 Author chain DT； PDBConstruct 1–137； UniProt 1–137 Author chain DU； PDBConstruct 1–137； UniProt 1–137 Author chain DV； PDBConstruct 1–137； UniProt 1–137 Author chain DW； PDBConstruct 1–137； UniProt 1–137 Author chain Da； PDBConstruct 1–137； UniProt 1–137 Author chain Db； PDBConstruct 1–137； UniProt 1–137 Author chain Dc； PDBConstruct 1–137； UniProt 1–137 Author chain Dg； PDBConstruct 1–137； UniProt 1–137 Author chain Dh； PDBConstruct 1–137； UniProt 1–137 Author chain Di； PDBConstruct 1–137； UniProt 1–137 Author chain Dm； PDBConstruct 1–137； UniProt 1–137 Author chain Dn； PDBConstruct 1–137； UniProt 1–137 Author chain Do； PDBConstruct 1–137； UniProt 1–137 Author chain Ds； PDBConstruct 1–137； UniProt 1–137 Author chain Dt； PDBConstruct 1–137； UniProt 1–137 Author chain Du； PDBConstruct 1–137； UniProt 1–137 Author chain Dy； PDBConstruct 1–137； UniProt 1–137 Author chain Dz； PDBConstruct 1–137； UniProt 1–137 Author chain EA； PDBConstruct 1–137； UniProt 1–137 Author chain EB； PDBConstruct 1–137； UniProt 1–137 Author chain EE； PDBConstruct 1–137； UniProt 1–137 Author chain EF； PDBConstruct 1–137； UniProt 1–137 Author chain EG； PDBConstruct 1–137； UniProt 1–137 Author chain EL； PDBConstruct 1–137； UniProt 1–137 Author chain EM； PDBConstruct 1–137； UniProt 1–137 Author chain EN； PDBConstruct 1–137； UniProt 1–137 Author chain ES； PDBConstruct 1–137； UniProt 1–137 Author chain ET； PDBConstruct 1–137； UniProt 1–137 Author chain EU； PDBConstruct 1–137； UniProt 1–137 Author chain EZ； PDBConstruct 1–137； UniProt 1–137 Author chain FC； PDBConstruct 1–137； UniProt 1–137 Author chain FD； PDBConstruct 1–137； UniProt 1–137 Author chain FE； PDBConstruct 1–137； UniProt 1–137 Author chain FF； PDBConstruct 1–137； UniProt 1–137 Author chain FG； PDBConstruct 1–137； UniProt 1–137 Author chain FH； PDBConstruct 1–137； UniProt 1–137 Author chain FI； PDBConstruct 1–137； UniProt 1–137 Author chain FJ； PDBConstruct 1–137； UniProt 1–137 Author chain FK； PDBConstruct 1–137； UniProt 1–137 Author chain FL； PDBConstruct 1–137； UniProt 1–137 Author chain FM； PDBConstruct 1–137； UniProt 1–137 Author chain FN； PDBConstruct 1–137； UniProt 1–137

Flagellar motor switch protein FliG

OrganismNot specified

UniProt P0A1J9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Chemotaxis protein CheY × 34 （P0A2D5） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIG_SALTY
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain B5； PDBConstruct 1–331； UniProt 1–331 Author chain Bc； PDBConstruct 1–331； UniProt 1–331 Author chain Bj； PDBConstruct 1–331； UniProt 1–331 Author chain Bq； PDBConstruct 1–331； UniProt 1–331 Author chain Bx； PDBConstruct 1–331； UniProt 1–331 Author chain C6； PDBConstruct 1–331； UniProt 1–331 Author chain CB； PDBConstruct 1–331； UniProt 1–331 Author chain CI； PDBConstruct 1–331； UniProt 1–331 Author chain CP； PDBConstruct 1–331； UniProt 1–331 Author chain CW； PDBConstruct 1–331； UniProt 1–331 Author chain Cd； PDBConstruct 1–331； UniProt 1–331 Author chain Ck； PDBConstruct 1–331； UniProt 1–331 Author chain Cr； PDBConstruct 1–331； UniProt 1–331 Author chain Cy； PDBConstruct 1–331； UniProt 1–331 Author chain D3； PDBConstruct 1–331； UniProt 1–331 Author chain D9； PDBConstruct 1–331； UniProt 1–331 Author chain DA； PDBConstruct 1–331； UniProt 1–331 Author chain DG； PDBConstruct 1–331； UniProt 1–331 Author chain DY； PDBConstruct 1–331； UniProt 1–331 Author chain De； PDBConstruct 1–331； UniProt 1–331 Author chain Dk； PDBConstruct 1–331； UniProt 1–331 Author chain Dq； PDBConstruct 1–331； UniProt 1–331 Author chain Dw； PDBConstruct 1–331； UniProt 1–331 Author chain E1； PDBConstruct 1–331； UniProt 1–331 Author chain E2； PDBConstruct 1–331； UniProt 1–331 Author chain E3； PDBConstruct 1–331； UniProt 1–331 Author chain E4； PDBConstruct 1–331； UniProt 1–331 Author chain EC； PDBConstruct 1–331； UniProt 1–331 Author chain EJ； PDBConstruct 1–331； UniProt 1–331 Author chain EQ； PDBConstruct 1–331； UniProt 1–331 Author chain EX； PDBConstruct 1–331； UniProt 1–331 Author chain Ex； PDBConstruct 1–331； UniProt 1–331 Author chain Ey； PDBConstruct 1–331； UniProt 1–331 Author chain Ez； PDBConstruct 1–331； UniProt 1–331

Chemotaxis protein CheY

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

UniProt P0A2D5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Flagellar motor switch protein FliM × 34 （P26418）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHEY_SALTY
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain B6； PDBConstruct 1–129； UniProt 1–129 Author chain Bd； PDBConstruct 1–129； UniProt 1–129 Author chain Bk； PDBConstruct 1–129； UniProt 1–129 Author chain Br； PDBConstruct 1–129； UniProt 1–129 Author chain By； PDBConstruct 1–129； UniProt 1–129 Author chain C7； PDBConstruct 1–129； UniProt 1–129 Author chain CC； PDBConstruct 1–129； UniProt 1–129 Author chain CJ； PDBConstruct 1–129； UniProt 1–129 Author chain CQ； PDBConstruct 1–129； UniProt 1–129 Author chain CX； PDBConstruct 1–129； UniProt 1–129 Author chain Ce； PDBConstruct 1–129； UniProt 1–129 Author chain Cl； PDBConstruct 1–129； UniProt 1–129 Author chain Cs； PDBConstruct 1–129； UniProt 1–129 Author chain Cz； PDBConstruct 1–129； UniProt 1–129 Author chain D0； PDBConstruct 1–129； UniProt 1–129 Author chain D4； PDBConstruct 1–129； UniProt 1–129 Author chain DB； PDBConstruct 1–129； UniProt 1–129 Author chain DH； PDBConstruct 1–129； UniProt 1–129 Author chain DZ； PDBConstruct 1–129； UniProt 1–129 Author chain Df； PDBConstruct 1–129； UniProt 1–129 Author chain Dl； PDBConstruct 1–129； UniProt 1–129 Author chain Dr； PDBConstruct 1–129； UniProt 1–129 Author chain Dx； PDBConstruct 1–129； UniProt 1–129 Author chain E0； PDBConstruct 1–129； UniProt 1–129 Author chain E6； PDBConstruct 1–129； UniProt 1–129 Author chain E7； PDBConstruct 1–129； UniProt 1–129 Author chain E8； PDBConstruct 1–129； UniProt 1–129 Author chain E9； PDBConstruct 1–129； UniProt 1–129 Author chain ED； PDBConstruct 1–129； UniProt 1–129 Author chain EK； PDBConstruct 1–129； UniProt 1–129 Author chain ER； PDBConstruct 1–129； UniProt 1–129 Author chain EY； PDBConstruct 1–129； UniProt 1–129 Author chain FA； PDBConstruct 1–129； UniProt 1–129 Author chain FB； PDBConstruct 1–129； UniProt 1–129

Flagellar motor switch protein FliM

OrganismNot specified

UniProt P26418

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 451	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar L-ring protein × 26 （P0A1N8） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar M-ring protein × 110 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook protein FlgE × 29 （P0A1J1） Flagellar P-ring protein × 26 （P15930） Flagellar motor switch protein FliN × 102 （P26419） Flagellar motor switch protein FliG × 34 （P0A1J9） Chemotaxis protein CheY × 34 （P0A2D5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIM_SALTY
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain B4； PDBConstruct 1–334； UniProt 1–334 Author chain Bb； PDBConstruct 1–334； UniProt 1–334 Author chain Bi； PDBConstruct 1–334； UniProt 1–334 Author chain Bp； PDBConstruct 1–334； UniProt 1–334 Author chain Bw； PDBConstruct 1–334； UniProt 1–334 Author chain C0； PDBConstruct 1–334； UniProt 1–334 Author chain CA； PDBConstruct 1–334； UniProt 1–334 Author chain CH； PDBConstruct 1–334； UniProt 1–334 Author chain CO； PDBConstruct 1–334； UniProt 1–334 Author chain CV； PDBConstruct 1–334； UniProt 1–334 Author chain Cc； PDBConstruct 1–334； UniProt 1–334 Author chain Cj； PDBConstruct 1–334； UniProt 1–334 Author chain Cq； PDBConstruct 1–334； UniProt 1–334 Author chain Cx； PDBConstruct 1–334； UniProt 1–334 Author chain D2； PDBConstruct 1–334； UniProt 1–334 Author chain D8； PDBConstruct 1–334； UniProt 1–334 Author chain DC； PDBConstruct 1–334； UniProt 1–334 Author chain DF； PDBConstruct 1–334； UniProt 1–334 Author chain DX； PDBConstruct 1–334； UniProt 1–334 Author chain Dd； PDBConstruct 1–334； UniProt 1–334 Author chain Dj； PDBConstruct 1–334； UniProt 1–334 Author chain Dp； PDBConstruct 1–334； UniProt 1–334 Author chain Dv； PDBConstruct 1–334； UniProt 1–334 Author chain E5； PDBConstruct 1–334； UniProt 1–334 Author chain EI； PDBConstruct 1–334； UniProt 1–334 Author chain EP； PDBConstruct 1–334； UniProt 1–334 Author chain EW； PDBConstruct 1–334； UniProt 1–334 Author chain Eq； PDBConstruct 1–334； UniProt 1–334 Author chain Er； PDBConstruct 1–334； UniProt 1–334 Author chain Es； PDBConstruct 1–334； UniProt 1–334 Author chain Et； PDBConstruct 1–334； UniProt 1–334 Author chain Eu； PDBConstruct 1–334； UniProt 1–334 Author chain Ev； PDBConstruct 1–334； UniProt 1–334 Author chain Ew； PDBConstruct 1–334； UniProt 1–334

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8woe
Deposition date deposition_date	2023-10-07
Structure title title	Cryo-EM structure of the intact flagellar motor-hook complex in the CW state
Keywords keywords	Flagellum, Flagellar motor, C ring, Switch complex, CheY, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8woe__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8woe__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8woe__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	236.20 Å
Total Rg	236.10 Å
Atom count	614043
Residues	80330
Excluded volume	10922000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8woe__assembly_1__model_1`	451-meric （451）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4,5,6,7,8,9,AF,AG,AH,AI,AJ,AK,AL,AM,AN,ZA,ZB,ZC,ZD,ZE
Atom count atom_count	614043

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 2 Entity 2 polymer

Description description	Flagellar L-ring protein
Molecular weight formula_weight	24726.7 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z

MQKYALHAYPVMALMVATLTGCAWIPAKPLVQGATTAQPIPGPVPVANGSIFQSAQPINYGYQPLFEDRRPRNIGDTLTIVLQENVSASKSSSANASRDGKTSFGFDTVPRYLQGLFGNSRADMEASGGNSFNGKGGANASNTFSGTLTVTVDQVLANGNLHVVGEKQIAINQGTEFIRFSGVVNPRTISGSNSVPSTQVADARIEYVGNGYINEAQNMGWLQRFFLNLSPM

Entity 3 Entity 3 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,A6,A7,A8,A9

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 4 Entity 4 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,A3,A4,A5,Az

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 5 Entity 5 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 6 Entity 6 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	110

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AO,AP,AQ,AR,AS,AT,AU,AV,AW,AX,AY,AZ,Aa,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao,Ap,BG,BH,BI,BJ,BK,BL,BM,BN,BO,BP,BQ,BR,BS,BT,BU,BV,BW,BX,UI,UJ,UK,UL,UM,UN,UO,UP,WA,WB,WC,WD,WE,WF,WG,WH,WI,WJ,WK,WL,WM,WN,WO,WP,WQ,WR,WS,WT,WU,WV,WW,DE,DL,B0,B3,EH,EO,EV,Ba,Bh,Bo,Bv,Ea,CG,CN,CU,Cb,Ci,Cp,Cw,Eb,Ec,Ed,Ee,Ef,Eg,Eh,Ei,Ej,Ek,El,Em,En,Eo,Ep ;

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 7 Entity 7 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab,Aq,Ar,As

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 8 Entity 8 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	At

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 9 Entity 9 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Au,Av,Aw,Ax,Ay

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 10 Entity 10 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB,BC,BD,BE,BF

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 11 Entity 11 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	29

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ZF,ZG,ZH,ZI,ZJ,ZK,ZL,ZM,ZN,ZO,ZP,ZQ,ZR,ZS,ZT,ZU,ZV,ZW,ZX,ZY,ZZ,Za,Zb,Zc,Zd,Ze,Zf,Zg,Zh

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

Entity 12 Entity 12 polymer

Description description	Flagellar P-ring protein
Molecular weight formula_weight	38194.2 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z

MFKALAGIVLALVATLAHAERIRDLTSVQGVRENSLIGYGLVVGLDGTGDQTTQTPFTTQTLNNMLSQLGITVPTGTNMQLKNVAAVMVTASYPPFARQGQTIDVVVSSMGNAKSLRGGTLLMTPLKGVDSQVYALAQGNILVGGAGASAGGSSVQVNQLNGGRITNGAIIERELPTQFGAGNTINLQLNDEDFTMAQQITDAINRARGYGSATALDARTVQVRVPSGNSSQVRFLADIQNMEVNVTPQDAKVVINSRTGSVVMNREVTLDSCAVAQGNLSVTVNRQLNVNQPNTPFGGGQTVVTPQTQIDLRQSGGSLQSVRSSANLNSVVRALNALGATPMDLMSILQSMQSAGCLRAKLEII

Entity 13 Entity 13 polymer

Description description	Flagellar motor switch protein FliN
Molecular weight formula_weight	14801.8 kDa
Source method src_method	nat
Copy count entity_count	102

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;C3,C4,C5,C8,C9,DD,DI,DJ,DK,DM,DN,DO,DP,DQ,DR,DS,DT,DU,DV,DW,Da,Db,Dc,Dg,Dh,Di,Dm,Dn,Do,Ds,Dt,Du,Dy,Dz,D1,D5,D6,D7,EA,EB,B1,B2,B7,B8,B9,EE,EF,EG,EL,EM,EN,ES,ET,EU,EZ,BY,BZ,Be,Bf,Bg,Bl,Bm,Bn,Bs,Bt,Bu,Bz,C1,C2,CD,CE,CF,CK,CL,CM,CR,CS,CT,CY,CZ,Ca,Cf,Cg,Ch,Cm,Cn,Co,Ct,Cu,Cv,FC,FD,FE,FF,FG,FH,FI,FJ,FK,FL,FM,FN ;

MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGGGDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

Entity 14 Entity 14 polymer

Description description	Flagellar motor switch protein FliG
Molecular weight formula_weight	36891.0 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C6,DA,DG,DY,De,Dk,Dq,Dw,D3,D9,B5,EC,EJ,EQ,EX,Bc,Bj,Bq,Bx,CB,CI,CP,CW,Cd,Ck,Cr,Cy,Ex,Ey,Ez,E1,E2,E3,E4

MSNLSGTDKSVILLMTIGEDRAAEVFKHLSTREVQALSTAMANVRQISNKQLTDVLSEFEQEAEQFAALNINANEYLRSVLVKALGEERASSLLEDILETRDTTSGIETLNFMEPQSAADLIRDEHPQIIATILVHLKRSQAADILALFDERLRHDVMLRIATFGGVQPAALAELTEVLNGLLDGQNLKRSKMGGVRTAAEIINLMKTQQEEAVITAVREFDGELAQKIIDEMFLFENLVDVDDRSIQRLLQEVDSESLLIALKGAEPPLREKFLRNMSQRAADILRDDLANRGPVRLSQVENEQKAILLIVRRLAETGEMVIGSGEDTYV

Entity 15 Entity 15 polymer

Description description	Chemotaxis protein CheY
Molecular weight formula_weight	14177.5 kDa
Mutation mutation	D13K, Y106W
Source method src_method	man
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C7,DB,DH,DZ,Df,Dl,Dr,Dx,D4,D0,B6,ED,EK,ER,EY,Bd,Bk,Br,By,CC,CJ,CQ,CX,Ce,Cl,Cs,Cz,E6,E7,E8,E9,E0,FA,FB

MADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 16 Entity 16 polymer

Description description	Flagellar motor switch protein FliM
Molecular weight formula_weight	37901.1 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C0,DC,DF,DX,Dd,Dj,Dp,Dv,D2,D8,B4,EI,EP,EW,Bb,Bi,Bp,Bw,CA,CH,CO,CV,Cc,Cj,Cq,Cx,Eq,Er,Es,Et,Eu,Ev,Ew,E5

MGDSILSQAEIDALLNGDSDTKDEPTPGIASDSDIRPYDPNTQRRVVRERLQALEIINERFARQFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFADIPLRLSQILKLKPGDVLPIEKPDRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINPILNSLNEEQPK

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	26921

Cryo-EM structure of the intact flagellar motor-hook complex in the CW state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar L-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer