SAXSdb — 2pmc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chemotaxis protein cheY

Salmonella typhimurium

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 2–129	Not recorded	Chemotaxis protein cheZ × 1 （P07800） MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.69 Å R-free 0.285
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 2–129	Not recorded	Chemotaxis protein cheZ × 1 （P07800） MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.69 Å R-free 0.285
3	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain C； UniProt 2–129	Not recorded	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.69 Å R-free 0.285
4	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain D； UniProt 2–129	Not recorded	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.69 Å R-free 0.285

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PMC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2CHE STRUCTURE OF THE MG2+-BOUND FORM OF CHEY AND MECHANISM OF PHOSPHORYL TRANSFER IN BACTERIAL CHEMOTAXIS Deposited 1994-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
2CHF STRUCTURE OF THE MG2+-BOUND FORM OF CHEY AND THE MECHANISM OF PHOSPHORYL TRANSFER IN BACTERIAL CHEMOTAXIS Deposited 1994-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
2CHY THREE-DIMENSIONAL STRUCTURE OF CHEY, THE RESPONSE REGULATOR OF BACTERIAL CHEMOTAXIS Deposited 1990-05-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å
2FKA Crystal structure of Mg(2+) and BeF(3)(-)-bound CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 2 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.224
2FKA Crystal structure of Mg(2+) and BeF(3)(-)-bound CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 12 SO4 SULFATE ION × 12 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 24 BEF BERYLLIUM TRIFLUORIDE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.224
2FLK Crystal structure of CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	SO4 SULFATE ION × 1 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.10 Å R-free 0.207
2FLK Crystal structure of CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 1–128（128 aa）	Not recorded	SO4 SULFATE ION × 24 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 48	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.10 Å R-free 0.207
2FLW Crystal structure of Mg2+ and BeF3- ound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5) Deposited 2006-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.228
2FMF Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.213
2FMH Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.246
2FMH Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 24 SO4 SULFATE ION × 24 BEF BERYLLIUM TRIFLUORIDE ION × 24 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 24 GOL GLYCEROL × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.246
2FMH Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 3 SO4 SULFATE ION × 3 BEF BERYLLIUM TRIFLUORIDE ION × 3 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 3 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.246
2FMI Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	SO4 SULFATE ION × 1 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.30 Å R-free 0.219
2FMI Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–128（128 aa）	Not recorded	SO4 SULFATE ION × 3 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 3 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.30 Å R-free 0.219
2FMK Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a P2(1)2(1)2 crystal grown in MES (pH 6.0) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5% PEG 8000, 0.05M sodium phosphate (monobasic), 0.1M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.232
2PL9 Crystal Structure of CheY-Mg(2+)-BeF(3)(-) in Complex with CheZ(C19) Peptide solved from a P2(1)2(1)2 Crystal Deposited 2007-04-19	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–129（128 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.274
2PL9 Crystal Structure of CheY-Mg(2+)-BeF(3)(-) in Complex with CheZ(C19) Peptide solved from a P2(1)2(1)2 Crystal Deposited 2007-04-19	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–129（128 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.274
2PL9 Crystal Structure of CheY-Mg(2+)-BeF(3)(-) in Complex with CheZ(C19) Peptide solved from a P2(1)2(1)2 Crystal Deposited 2007-04-19	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–129（128 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.274
8WIW Cryo-EM structure of the flagellar C ring in the CW state Deposited 2023-09-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 238 PDB declaration: 238-meric	Chain 4 1–129（129 aa） Chain 9 1–129（129 aa） Chain A5 1–129（129 aa） Chain AN 1–129（129 aa） Chain AT 1–129（129 aa） Chain AZ 1–129（129 aa） Chain Af 1–129（129 aa） Chain Al 1–129（129 aa） Chain Ar 1–129（129 aa） Chain Ax 1–129（129 aa） Chain B6 1–129（129 aa） Chain BB 1–129（129 aa） Chain BI 1–129（129 aa） Chain BP 1–129（129 aa） Chain BW 1–129（129 aa） Chain Bd 1–129（129 aa） Chain Bk 1–129（129 aa） Chain Br 1–129（129 aa） Chain By 1–129（129 aa） Chain CC 1–129（129 aa） Chain CJ 1–129（129 aa） Chain CQ 1–129（129 aa） Chain CX 1–129（129 aa） Chain Ce 1–129（129 aa） Chain Cl 1–129（129 aa） Chain Cs 1–129（129 aa） Chain Cz 1–129（129 aa） Chain h 1–129（129 aa） Chain i 1–129（129 aa） Chain j 1–129（129 aa） Chain k 1–129（129 aa） Chain l 1–129（129 aa） Chain m 1–129（129 aa） Chain n 1–129（129 aa）	Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 5.60 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain B6 1–129（129 aa） Chain Bd 1–129（129 aa） Chain Bk 1–129（129 aa） Chain Br 1–129（129 aa） Chain By 1–129（129 aa） Chain C7 1–129（129 aa） Chain CC 1–129（129 aa） Chain CJ 1–129（129 aa） Chain CQ 1–129（129 aa） Chain CX 1–129（129 aa） Chain Ce 1–129（129 aa） Chain Cl 1–129（129 aa） Chain Cs 1–129（129 aa） Chain Cz 1–129（129 aa） Chain D0 1–129（129 aa） Chain D4 1–129（129 aa） Chain DB 1–129（129 aa） Chain DH 1–129（129 aa） Chain DZ 1–129（129 aa） Chain Df 1–129（129 aa） Chain Dl 1–129（129 aa） Chain Dr 1–129（129 aa） Chain Dx 1–129（129 aa） Chain E0 1–129（129 aa） Chain E6 1–129（129 aa） Chain E7 1–129（129 aa） Chain E8 1–129（129 aa） Chain E9 1–129（129 aa） Chain ED 1–129（129 aa） Chain EK 1–129（129 aa） Chain ER 1–129（129 aa） Chain EY 1–129（129 aa） Chain FA 1–129（129 aa） Chain FB 1–129（129 aa）	Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
8XP1 Cryo-EM structure of the protomers of the C ring in the CW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain h 1–129（129 aa） Chain i 1–129（129 aa） Chain j 1–129（129 aa）	Mutation：D13K, Y106W Mutation：D13K, Y106W Mutation：D13K, Y106W	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.40 Å

14 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CHEY_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–128； UniProt 2–129 Author chain B； PDBConstruct 1–128； UniProt 2–129 Author chain C； PDBConstruct 1–128； UniProt 2–129 Author chain D； PDBConstruct 1–128； UniProt 2–129

Chemotaxis protein cheZ

OrganismNot specified

UniProt P07800

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 200–214	Not recorded	Chemotaxis protein cheY × 1 （P0A2D5） MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.69 Å R-free 0.285
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 200–214	Not recorded	Chemotaxis protein cheY × 1 （P0A2D5） MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.69 Å R-free 0.285

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PMC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2FKA Crystal structure of Mg(2+) and BeF(3)(-)-bound CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 2 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.224
2FLK Crystal structure of CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	SO4 SULFATE ION × 1 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.10 Å R-free 0.207
2FLK Crystal structure of CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5) Deposited 2006-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	SO4 SULFATE ION × 24 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 48	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M CAPS, pH 10.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.10 Å R-free 0.207
2FLW Crystal structure of Mg2+ and BeF3- ound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5) Deposited 2006-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.228
2FMF Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.213
2FMH Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.246
2FMH Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	MG MAGNESIUM ION × 24 SO4 SULFATE ION × 24 BEF BERYLLIUM TRIFLUORIDE ION × 24 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 24 GOL GLYCEROL × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.246
2FMH Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	MG MAGNESIUM ION × 3 SO4 SULFATE ION × 3 BEF BERYLLIUM TRIFLUORIDE ION × 3 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 3 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.246
2FMI Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	SO4 SULFATE ION × 1 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.30 Å R-free 0.219
2FMI Crystal structure of CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Tris (pH 8.4) Deposited 2006-01-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 200–214（15 aa） Fragment：residues 200-214	Not recorded	SO4 SULFATE ION × 3 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 3 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；2M ammonium sulfate, 0.2M lithium sulfate, 0.1M Tris, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.30 Å R-free 0.219
2FMK Crystal structure of Mg2+ and BeF3- bound CheY in complex with CheZ 200-214 solved from a P2(1)2(1)2 crystal grown in MES (pH 6.0) Deposited 2006-01-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 200–214（15 aa） Fragment：residues 200-214	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5% PEG 8000, 0.05M sodium phosphate (monobasic), 0.1M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.232
2PL9 Crystal Structure of CheY-Mg(2+)-BeF(3)(-) in Complex with CheZ(C19) Peptide solved from a P2(1)2(1)2 Crystal Deposited 2007-04-19	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 196–214（19 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.274
2PL9 Crystal Structure of CheY-Mg(2+)-BeF(3)(-) in Complex with CheZ(C19) Peptide solved from a P2(1)2(1)2 Crystal Deposited 2007-04-19	Different construct Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 196–214（19 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.274
2PL9 Crystal Structure of CheY-Mg(2+)-BeF(3)(-) in Complex with CheZ(C19) Peptide solved from a P2(1)2(1)2 Crystal Deposited 2007-04-19	Different construct Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 196–214（19 aa）	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；37.5 % PEG 8000, 0.1 M ammonium thiocyanate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.60 Å R-free 0.274

8 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CHEZ_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–15； UniProt 200–214 Author chain F； PDBConstruct 1–15； UniProt 200–214

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2pmc
Deposition date deposition_date	2007-04-20
Structure title title	Crystal Structure of CheY-Mg(2+) in Complex with CheZ(C15) Peptide solved from a P1 Crystal
Keywords keywords	CHEMOTAXIS, CHEY-CHEZ PEPTIDE COMPLEX, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	27.54 Å
Radius of gyration Rg (electron density) rg_electron	26.74 Å
Forward intensity I(0) i0	52063700.00
Molecular weight molecular_weight	57763.0 kDa
Excluded volume excluded_volume	73115 Å³
Envelope volume envelope_volume	92472 Å³
Hydration-shell volume shell_volume	29042 Å³
Envelope diameter envelope_diameter	93.3 Å
Shell Rg shell_rg	33.67 Å
Envelope Rg envelope_rg	26.59 Å
Shape Rg shape_rg	26.73 Å
Total Rg total_rg	27.55 Å
Total atoms total_atoms	4050
Residues n_residues	528
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	87.7 Å
Rg (real space) rg_real	27.44 Å
Rg uncertainty (real space) rg_real_error	0.69 Å
I(0) (real space) i0_real	5.2060e+07
I(0) uncertainty (real space) i0_real_error	7.5960e+05
Rg (reciprocal space) rg_reciprocal	27.48 Å
I(0) (reciprocal space) i0_reciprocal	52060000.0000
Solution quality estimate total_estimate	0.8268
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	39.3 Å
Skewness Skewness skewness	0.176
Kurtosis Kurtosis kurtosis	-0.545
Angular range angular_range	— – 0.2900 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	26280000.0000
Real-space data points n_real_points	59
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.915; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Chemotaxis protein cheY
Molecular weight formula_weight	14009.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4066

ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM

来源 Source

来源生物 organism	Salmonella typhimurium
NCBI Class编号 ncbi_taxonomy_id	99287
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Chemotaxis protein cheZ
Molecular weight formula_weight	1622.7 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

ASQDQVDDLLDSLGF

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	16

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2pmca_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.23 — Flavodoxin-like
Superfamily Superfamily superfamily	c.23.1 — CheY-like
Family Family family	c.23.1.1 — CheY-related

Domain ID domain_id	d2pmcb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.23 — Flavodoxin-like
Superfamily Superfamily superfamily	c.23.1 — CheY-like
Family Family family	c.23.1.1 — CheY-related

Domain ID domain_id	d2pmcc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.23 — Flavodoxin-like
Superfamily Superfamily superfamily	c.23.1 — CheY-like
Family Family family	c.23.1.1 — CheY-related

Domain ID domain_id	d2pmcd_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.23 — Flavodoxin-like
Superfamily Superfamily superfamily	c.23.1 — CheY-like
Family Family family	c.23.1.1 — CheY-related

CATH v4.4 (4 domains)

Domain ID domain_id	2pmcA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2300 — Response regulator

Domain ID domain_id	2pmcB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2300 — Response regulator

Domain ID domain_id	2pmcC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2300 — Response regulator

Domain ID domain_id	2pmcD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2300 — Response regulator

▶

8. Citations (1)

▶

Unit-cell length a length_a	34.760 Å
Unit-cell length b length_b	53.672 Å
Unit-cell length c length_c	65.641 Å
Unit-cell angle α angle_alpha	90.22 °
Unit-cell angle β angle_beta	102.92 °
Unit-cell angle γ angle_gamma	90.18 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.688 Å
Low-resolution limit resolution_low	28.590 Å
R factor r_factor	0.2130
R_work r_work	0.2050
R_free r_free	0.2850

fit	/app/data/saxs_computation/pm/2pmc/2pmc.fit
pddf	/app/data/pr_computation/pm/2pmc/2pmc.pr.out
profile	/app/data/saxs_computation/pm/2pmc/2pmc.dat

Crystal Structure of CheY-Mg(2+) in Complex with CheZ(C15) Peptide solved from a P1 Crystal

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chemotaxis protein cheY

State in the Current Structure

Other States of the Same Protein in the Database

Chemotaxis protein cheZ

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)