7bin

Salmonella export gate and rod refined in focussed C1 map

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8Z5R3_SALTI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–245； UniProt 1–245 Author chain B； PDBConstruct 1–245； UniProt 1–245 Author chain C； PDBConstruct 1–245； UniProt 1–245 Author chain D； PDBConstruct 1–245； UniProt 1–245 Author chain E； PDBConstruct 1–245； UniProt 1–245

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt A0A3U0BCQ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3U0BCQ2_SALET
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt A0A3Y0WXN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A3Y0WXN7_SALET
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–89； UniProt 1–89 Author chain H； PDBConstruct 1–89； UniProt 1–89 Author chain I； PDBConstruct 1–89； UniProt 1–89 Author chain J； PDBConstruct 1–89； UniProt 1–89

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–104； UniProt 1–104 Author chain L； PDBConstruct 1–104； UniProt 1–104 Author chain M； PDBConstruct 1–104； UniProt 1–104 Author chain N； PDBConstruct 1–104； UniProt 1–104 Author chain O； PDBConstruct 1–104； UniProt 1–104 Author chain P； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Q； PDBConstruct 1–138； UniProt 1–138 Author chain R； PDBConstruct 1–138； UniProt 1–138 Author chain S； PDBConstruct 1–138； UniProt 1–138 Author chain T； PDBConstruct 1–138； UniProt 1–138 Author chain U； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain V； PDBConstruct 1–134； UniProt 1–134 Author chain W； PDBConstruct 1–134； UniProt 1–134 Author chain X； PDBConstruct 1–134； UniProt 1–134 Author chain Y； PDBConstruct 1–134； UniProt 1–134 Author chain Z； PDBConstruct 1–134； UniProt 1–134 Author chain a； PDBConstruct 1–134； UniProt 1–134

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt P16323

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgG × 24 （P0A1J3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGF_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain b； PDBConstruct 1–251； UniProt 1–251 Author chain c； PDBConstruct 1–251； UniProt 1–251 Author chain d； PDBConstruct 1–251； UniProt 1–251 Author chain e； PDBConstruct 1–251； UniProt 1–251 Author chain f； PDBConstruct 1–251； UniProt 1–251

Flagellar basal-body rod protein FlgG

OrganismNot specified

UniProt P0A1J3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Flagellar biosynthetic protein FliP × 5 （Q8Z5R3） Flagellar biosynthetic protein FliR × 1 （A0A3U0BCQ2） Flagellar biosynthetic protein FliQ × 4 （A0A3Y0WXN7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal-body rod protein FlgF × 5 （P16323）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGG_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 1； PDBConstruct 1–260； UniProt 1–260 Author chain 2； PDBConstruct 1–260； UniProt 1–260 Author chain 3； PDBConstruct 1–260； UniProt 1–260 Author chain 4； PDBConstruct 1–260； UniProt 1–260 Author chain g； PDBConstruct 1–260； UniProt 1–260 Author chain h； PDBConstruct 1–260； UniProt 1–260 Author chain i； PDBConstruct 1–260； UniProt 1–260 Author chain j； PDBConstruct 1–260； UniProt 1–260 Author chain k； PDBConstruct 1–260； UniProt 1–260 Author chain l； PDBConstruct 1–260； UniProt 1–260 Author chain m； PDBConstruct 1–260； UniProt 1–260 Author chain n； PDBConstruct 1–260； UniProt 1–260 Author chain o； PDBConstruct 1–260； UniProt 1–260 Author chain p； PDBConstruct 1–260； UniProt 1–260 Author chain q； PDBConstruct 1–260； UniProt 1–260 Author chain r； PDBConstruct 1–260； UniProt 1–260 Author chain s； PDBConstruct 1–260； UniProt 1–260 Author chain t； PDBConstruct 1–260； UniProt 1–260 Author chain u； PDBConstruct 1–260； UniProt 1–260 Author chain v； PDBConstruct 1–260； UniProt 1–260 Author chain w； PDBConstruct 1–260； UniProt 1–260 Author chain x； PDBConstruct 1–260； UniProt 1–260 Author chain y； PDBConstruct 1–260； UniProt 1–260 Author chain z； PDBConstruct 1–260； UniProt 1–260

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bin
Deposition date deposition_date	2021-01-12
Structure title title	Salmonella export gate and rod refined in focussed C1 map
Keywords keywords	bacterial flagellum rod bacterial flagellum export gate basal body, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bin__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bin__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bin__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	82.70 Å
Rg (electron density)	86.15 Å
Total Rg	86.20 Å
Atom count	81721
Residues	10887
Excluded volume	1454400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bin__assembly_1__model_1`	56-meric （56）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	81721

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 4 Entity 4 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 5 Entity 5 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T,U

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 6 Entity 6 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X,Y,Z,a

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 7 Entity 7 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,c,d,e,f

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 8 Entity 8 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z,1,2,3,4

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	60497

Salmonella export gate and rod refined in focussed C1 map

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bin__assembly_1__model_1

7bin__assembly_1__model_1 | I(q)

7bin__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer