7e80

Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella

Method: ELECTRON MICROSCOPY D_max: 285.0 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain A； UniProt 1–260 Chain B； UniProt 1–260 Chain C； UniProt 1–260 Chain D； UniProt 1–260 Chain E； UniProt 1–260 Chain F； UniProt 1–260 Chain G； UniProt 1–260 Chain H； UniProt 1–260 Chain I； UniProt 1–260 Chain J； UniProt 1–260 Chain K； UniProt 1–260 Chain L； UniProt 1–260 Chain M； UniProt 1–260 Chain N； UniProt 1–260 Chain O； UniProt 1–260 Chain P； UniProt 1–260 Chain Q； UniProt 1–260 Chain R； UniProt 1–260 Chain S； UniProt 1–260 Chain T； UniProt 1–260 Chain U； UniProt 1–260 Chain V； UniProt 1–260 Chain W； UniProt 1–260 Chain X； UniProt 1–260	Not recorded	Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5WRH FlgG structure based on the CryoEM map of the bacterial flagellar polyrod Deposited 2016-12-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.40 Å
5WRH FlgG structure based on the CryoEM map of the bacterial flagellar polyrod Deposited 2016-12-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.40 Å
5WRH FlgG structure based on the CryoEM map of the bacterial flagellar polyrod Deposited 2016-12-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.40 Å
6JF2 Crystal structure of a 20kDa fragment of FlgG Deposited 2019-02-08	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–227（181 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；277 K；28-32% PEG monomethyl ether 2000, 0.1M acetate buffer (pH4.6), 0.2M ammonium sulfate	Resolution 2.00 Å R-free 0.229
6JF2 Crystal structure of a 20kDa fragment of FlgG Deposited 2019-02-08	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–227（181 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；277 K；28-32% PEG monomethyl ether 2000, 0.1M acetate buffer (pH4.6), 0.2M ammonium sulfate	Resolution 2.00 Å R-free 0.229
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain g 1–260（260 aa） Chain h 1–260（260 aa） Chain i 1–260（260 aa） Chain j 1–260（260 aa） Chain k 1–260（260 aa） Chain l 1–260（260 aa） Chain m 1–260（260 aa） Chain n 1–260（260 aa） Chain o 1–260（260 aa） Chain p 1–260（260 aa） Chain q 1–260（260 aa） Chain r 1–260（260 aa） Chain s 1–260（260 aa） Chain t 1–260（260 aa） Chain u 1–260（260 aa） Chain v 1–260（260 aa） Chain w 1–260（260 aa） Chain x 1–260（260 aa） Chain y 1–260（260 aa） Chain z 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CBM Cryo-EM structure of the flagellar distal rod with partial hook from Salmonella Deposited 2020-06-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 1–260（260 aa） Chain B 1–260（260 aa） Chain C 1–260（260 aa） Chain D 1–260（260 aa） Chain E 1–260（260 aa） Chain F 1–260（260 aa） Chain G 1–260（260 aa） Chain H 1–260（260 aa） Chain I 1–260（260 aa） Chain J 1–260（260 aa） Chain K 1–260（260 aa） Chain L 1–260（260 aa） Chain M 1–260（260 aa） Chain N 1–260（260 aa） Chain O 1–260（260 aa） Chain P 1–260（260 aa） Chain Q 1–260（260 aa） Chain R 1–260（260 aa） Chain S 1–260（260 aa） Chain T 1–260（260 aa） Chain U 1–260（260 aa） Chain V 1–260（260 aa） Chain W 1–260（260 aa） Chain X 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain A 1–260（260 aa） Chain B 1–260（260 aa） Chain C 1–260（260 aa） Chain D 1–260（260 aa） Chain E 1–260（260 aa） Chain F 1–260（260 aa） Chain G 1–260（260 aa） Chain H 1–260（260 aa） Chain I 1–260（260 aa） Chain J 1–260（260 aa） Chain K 1–260（260 aa） Chain L 1–260（260 aa） Chain M 1–260（260 aa） Chain N 1–260（260 aa） Chain O 1–260（260 aa） Chain P 1–260（260 aa） Chain Q 1–260（260 aa） Chain R 1–260（260 aa） Chain S 1–260（260 aa） Chain T 1–260（260 aa） Chain U 1–260（260 aa） Chain V 1–260（260 aa） Chain W 1–260（260 aa） Chain X 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain A 1–260（260 aa） Chain B 1–260（260 aa） Chain C 1–260（260 aa） Chain D 1–260（260 aa） Chain E 1–260（260 aa） Chain F 1–260（260 aa） Chain G 1–260（260 aa） Chain H 1–260（260 aa） Chain I 1–260（260 aa） Chain J 1–260（260 aa） Chain K 1–260（260 aa） Chain L 1–260（260 aa） Chain M 1–260（260 aa） Chain N 1–260（260 aa） Chain O 1–260（260 aa） Chain P 1–260（260 aa） Chain Q 1–260（260 aa） Chain R 1–260（260 aa） Chain S 1–260（260 aa） Chain T 1–260（260 aa） Chain U 1–260（260 aa） Chain V 1–260（260 aa） Chain W 1–260（260 aa） Chain X 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WKI Cryo-EM structure of the distal rod-hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa） Chain r 1–260（260 aa） Chain s 1–260（260 aa） Chain t 1–260（260 aa） Chain u 1–260（260 aa） Chain v 1–260（260 aa） Chain w 1–260（260 aa） Chain x 1–260（260 aa） Chain y 1–260（260 aa） Chain z 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa） Chain r 1–260（260 aa） Chain s 1–260（260 aa） Chain t 1–260（260 aa） Chain u 1–260（260 aa） Chain v 1–260（260 aa） Chain w 1–260（260 aa） Chain x 1–260（260 aa） Chain y 1–260（260 aa） Chain z 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain AF 1–260（260 aa） Chain AG 1–260（260 aa） Chain AH 1–260（260 aa） Chain AI 1–260（260 aa） Chain AJ 1–260（260 aa） Chain AK 1–260（260 aa） Chain AL 1–260（260 aa） Chain AM 1–260（260 aa） Chain AN 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLP Cryo-EM structure of the distal rod-hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa） Chain r 1–260（260 aa） Chain s 1–260（260 aa） Chain t 1–260（260 aa） Chain u 1–260（260 aa） Chain v 1–260（260 aa） Chain w 1–260（260 aa） Chain x 1–260（260 aa） Chain y 1–260（260 aa） Chain z 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa） Chain r 1–260（260 aa） Chain s 1–260（260 aa） Chain t 1–260（260 aa） Chain u 1–260（260 aa） Chain v 1–260（260 aa） Chain w 1–260（260 aa） Chain x 1–260（260 aa） Chain y 1–260（260 aa） Chain z 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain AF 1–260（260 aa） Chain AG 1–260（260 aa） Chain AH 1–260（260 aa） Chain AI 1–260（260 aa） Chain AJ 1–260（260 aa） Chain AK 1–260（260 aa） Chain AL 1–260（260 aa） Chain AM 1–260（260 aa） Chain AN 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain AF 1–260（260 aa） Chain AG 1–260（260 aa） Chain AH 1–260（260 aa） Chain AI 1–260（260 aa） Chain AJ 1–260（260 aa） Chain AK 1–260（260 aa） Chain AL 1–260（260 aa） Chain AM 1–260（260 aa） Chain AN 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain 0 1–260（260 aa） Chain 1 1–260（260 aa） Chain 2 1–260（260 aa） Chain 3 1–260（260 aa） Chain 4 1–260（260 aa） Chain 5 1–260（260 aa） Chain 6 1–260（260 aa） Chain 7 1–260（260 aa） Chain 8 1–260（260 aa） Chain 9 1–260（260 aa） Chain AF 1–260（260 aa） Chain AG 1–260（260 aa） Chain AH 1–260（260 aa） Chain AI 1–260（260 aa） Chain AJ 1–260（260 aa） Chain AK 1–260（260 aa） Chain AL 1–260（260 aa） Chain AM 1–260（260 aa） Chain AN 1–260（260 aa） Chain ZA 1–260（260 aa） Chain ZB 1–260（260 aa） Chain ZC 1–260（260 aa） Chain ZD 1–260（260 aa） Chain ZE 1–260（260 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

14 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGG_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–260； UniProt 1–260 Author chain B； PDBConstruct 1–260； UniProt 1–260 Author chain C； PDBConstruct 1–260； UniProt 1–260 Author chain D； PDBConstruct 1–260； UniProt 1–260 Author chain E； PDBConstruct 1–260； UniProt 1–260 Author chain F； PDBConstruct 1–260； UniProt 1–260 Author chain G； PDBConstruct 1–260； UniProt 1–260 Author chain H； PDBConstruct 1–260； UniProt 1–260 Author chain I； PDBConstruct 1–260； UniProt 1–260 Author chain J； PDBConstruct 1–260； UniProt 1–260 Author chain K； PDBConstruct 1–260； UniProt 1–260 Author chain L； PDBConstruct 1–260； UniProt 1–260 Author chain M； PDBConstruct 1–260； UniProt 1–260 Author chain N； PDBConstruct 1–260； UniProt 1–260 Author chain O； PDBConstruct 1–260； UniProt 1–260 Author chain P； PDBConstruct 1–260； UniProt 1–260 Author chain Q； PDBConstruct 1–260； UniProt 1–260 Author chain R； PDBConstruct 1–260； UniProt 1–260 Author chain S； PDBConstruct 1–260； UniProt 1–260 Author chain T； PDBConstruct 1–260； UniProt 1–260 Author chain U； PDBConstruct 1–260； UniProt 1–260 Author chain V； PDBConstruct 1–260； UniProt 1–260 Author chain W； PDBConstruct 1–260； UniProt 1–260 Author chain X； PDBConstruct 1–260； UniProt 1–260

Flagellar basal-body rod protein FlgF

OrganismNot specified

UniProt P16323

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain a； UniProt 1–251 Chain b； UniProt 1–251 Chain c； UniProt 1–251 Chain d； UniProt 1–251 Chain e； UniProt 1–251	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain b 1–251（251 aa） Chain c 1–251（251 aa） Chain d 1–251（251 aa） Chain e 1–251（251 aa） Chain f 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CBM Cryo-EM structure of the flagellar distal rod with partial hook from Salmonella Deposited 2020-06-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain a 1–251（251 aa） Chain b 1–251（251 aa） Chain c 1–251（251 aa） Chain d 1–251（251 aa） Chain e 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain a 1–251（251 aa） Chain b 1–251（251 aa） Chain c 1–251（251 aa） Chain d 1–251（251 aa） Chain e 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain a 1–251（251 aa） Chain b 1–251（251 aa） Chain c 1–251（251 aa） Chain d 1–251（251 aa） Chain e 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain m 1–251（251 aa） Chain n 1–251（251 aa） Chain o 1–251（251 aa） Chain p 1–251（251 aa） Chain q 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain m 1–251（251 aa） Chain n 1–251（251 aa） Chain o 1–251（251 aa） Chain p 1–251（251 aa） Chain q 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AA 1–251（251 aa） Chain AB 1–251（251 aa） Chain AC 1–251（251 aa） Chain AD 1–251（251 aa） Chain AE 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain m 1–251（251 aa） Chain n 1–251（251 aa） Chain o 1–251（251 aa） Chain p 1–251（251 aa） Chain q 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain m 1–251（251 aa） Chain n 1–251（251 aa） Chain o 1–251（251 aa） Chain p 1–251（251 aa） Chain q 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AA 1–251（251 aa） Chain AB 1–251（251 aa） Chain AC 1–251（251 aa） Chain AD 1–251（251 aa） Chain AE 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain AA 1–251（251 aa） Chain AB 1–251（251 aa） Chain AC 1–251（251 aa） Chain AD 1–251（251 aa） Chain AE 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain AA 1–251（251 aa） Chain AB 1–251（251 aa） Chain AC 1–251（251 aa） Chain AD 1–251（251 aa） Chain AE 1–251（251 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGF_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–251； UniProt 1–251 Author chain b； PDBConstruct 1–251； UniProt 1–251 Author chain c； PDBConstruct 1–251； UniProt 1–251 Author chain d； PDBConstruct 1–251； UniProt 1–251 Author chain e； PDBConstruct 1–251； UniProt 1–251

Flagellar MS ring L1

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain 5； UniProt 311–331 Chain 6； UniProt 311–331 Chain 7； UniProt 311–331 Chain 8； UniProt 311–331 Chain 9； UniProt 311–331	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6SD1 Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 33-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
6SD2 Structure of the RBM2inner region of the Salmonella flagella MS-ring protein FliF with 21-fold symmetry applied. Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 21 PDB declaration: 21-meric	Chain A 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain L 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain W 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6SD3 34mer structure of the Salmonella flagella MS-ring protein FliF Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6SD4 Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 34-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
6SD5 Structure of the RBM2 inner ring of Salmonella flagella MS-ring protein FliF with 22-fold symmetry applied Deposited 2019-07-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain R 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6TRE Structure of the RBM3/collar region of the Salmonella flagella MS-ring protein FliF with 32-fold symmetry applied Deposited 2019-12-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 32 PDB declaration: 32-meric	Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7BK0 Salmonella FliF ring (34mer) in intact basal body - C1 Deposited 2021-01-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CG7 Cryo-EM structure of the flagellar MS ring with C34 symmetry from Salmonella Deposited 2020-06-30	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.61 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa） Chain Ca 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Cc 1–560（560 aa） Chain Cd 1–560（560 aa） Chain Ce 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cg 1–560（560 aa） Chain Ch 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cj 1–560（560 aa） Chain Ck 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cm 1–560（560 aa） Chain Cn 1–560（560 aa） Chain Co 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cq 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cs 1–560（560 aa） Chain Ct 1–560（560 aa） Chain Cu 1–560（560 aa） Chain Cv 1–560（560 aa） Chain Cw 1–560（560 aa） Chain Cx 1–560（560 aa） Chain Cy 1–560（560 aa） Chain Cz 1–560（560 aa） Chain Da 1–560（560 aa） Chain Db 1–560（560 aa） Chain Dc 1–560（560 aa） Chain Dd 1–560（560 aa） Chain De 1–560（560 aa） Chain Df 1–560（560 aa） Chain Dg 1–560（560 aa） Chain Dh 1–560（560 aa） Chain Di 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dk 1–560（560 aa） Chain Dl 1–560（560 aa） Chain Dm 1–560（560 aa） Chain Dn 1–560（560 aa） Chain Do 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dq 1–560（560 aa） Chain Dr 1–560（560 aa） Chain Ds 1–560（560 aa） Chain Dt 1–560（560 aa） Chain Du 1–560（560 aa） Chain Dv 1–560（560 aa） Chain Dw 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Eh 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7D84 34-fold symmetry Salmonella S ring formed by full-length FliF Deposited 2020-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7E81 Cryo-EM structure of the flagellar MS ring with FlgB-Dc loop and FliE-helix 1 from Salmonella Deposited 2021-02-28	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 68 PDB declaration: 68-meric	Chain Ca 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Cc 1–560（560 aa） Chain Cd 1–560（560 aa） Chain Ce 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Ch 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cj 1–560（560 aa） Chain Ck 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cm 1–560（560 aa） Chain Cn 1–560（560 aa） Chain Co 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cq 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cs 1–560（560 aa） Chain Ct 1–560（560 aa） Chain Cu 1–560（560 aa） Chain Cv 1–560（560 aa） Chain Cw 1–560（560 aa） Chain Cx 1–560（560 aa） Chain Cy 1–560（560 aa） Chain Cz 1–560（560 aa） Chain Da 1–560（560 aa） Chain Db 1–560（560 aa） Chain Dc 1–560（560 aa） Chain Dd 1–560（560 aa） Chain De 1–560（560 aa） Chain Df 1–560（560 aa） Chain Dg 1–560（560 aa） Chain Dh 1–560（560 aa） Chain Di 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dk 1–560（560 aa） Chain Dl 1–560（560 aa） Chain Dm 1–560（560 aa） Chain Dn 1–560（560 aa） Chain Do 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dq 1–560（560 aa） Chain Dr 1–560（560 aa） Chain Ds 1–560（560 aa） Chain Dt 1–560（560 aa） Chain Du 1–560（560 aa） Chain Dv 1–560（560 aa） Chain Dw 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Fh 1–560（560 aa） Chain cg 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 4.50 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain 5 311–331（21 aa） Chain 6 311–331（21 aa） Chain 7 311–331（21 aa） Chain 8 311–331（21 aa） Chain 9 311–331（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
7NVG Salmonella flagellar basal body refined in C1 map Deposited 2021-03-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 147 PDB declaration: 147-meric	Chain A1 1–560（560 aa） Chain B1 1–560（560 aa） Chain C1 1–560（560 aa） Chain D1 1–560（560 aa） Chain E1 1–560（560 aa） Chain F1 1–560（560 aa） Chain G1 1–560（560 aa） Chain H1 1–560（560 aa） Chain I1 1–560（560 aa） Chain J1 1–560（560 aa） Chain K1 1–560（560 aa） Chain L1 1–560（560 aa） Chain M1 1–560（560 aa） Chain N1 1–560（560 aa） Chain O1 1–560（560 aa） Chain P1 1–560（560 aa） Chain Q1 1–560（560 aa） Chain R1 1–560（560 aa） Chain S1 1–560（560 aa） Chain T1 1–560（560 aa） Chain U1 1–560（560 aa） Chain V1 1–560（560 aa） Chain W1 1–560（560 aa） Chain X1 1–560（560 aa） Chain Y1 1–560（560 aa） Chain Z1 1–560（560 aa） Chain a1 1–560（560 aa） Chain b1 1–560（560 aa） Chain c1 1–560（560 aa） Chain d1 1–560（560 aa） Chain e1 1–560（560 aa） Chain f1 1–560（560 aa） Chain g1 1–560（560 aa） Chain h1 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8FTE CryoEM strucutre of 22-mer RBM2 of the Salmonella MS-ring Deposited 2023-01-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1 % Ana-grade LDAO cryo-EM vitrification conditions Cryogen ETHANE；Purified MS-rings were added to each grid at 277.15K at 100% humidity. After 30 sec of incubation, blotting was performed for 12 sec. The grid was then plunged into liquid ethane using a Vitrobot Mark IV system (Thermo Fisher)	Resolution 3.80 Å
8FTF CryoEM strucutre of 33-mer RBM3 of the Salmonella MS-ring Deposited 2023-01-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain AA 1–560（560 aa） Chain B 1–560（560 aa） Chain BA 1–560（560 aa） Chain C 1–560（560 aa） Chain CA 1–560（560 aa） Chain D 1–560（560 aa） Chain DA 1–560（560 aa） Chain E 1–560（560 aa） Chain EA 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain G 1–560（560 aa） Chain GA 1–560（560 aa） Chain H 1–560（560 aa） Chain HA 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1 % Ana-grade LDAO cryo-EM vitrification conditions Cryogen ETHANE；Purified MS-rings were added to each grid at 277.15K at 100% humidity. After 30 sec of incubation, blotting was performed for 12 sec. The grid was then plunged into liquid ethane using a Vitrobot Mark IV system (Thermo Fisher)	Resolution 2.90 Å
8T8P 33-mer FliF MS-ring from Salmonella Deposited 2023-06-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain AA 1–560（560 aa） Chain B 1–560（560 aa） Chain BA 1–560（560 aa） Chain C 1–560（560 aa） Chain CA 1–560（560 aa） Chain D 1–560（560 aa） Chain DA 1–560（560 aa） Chain E 1–560（560 aa） Chain EA 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain G 1–560（560 aa） Chain GA 1–560（560 aa） Chain H 1–560（560 aa） Chain HA 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8UMD Cryo-EM structure of a single subunit of a Counterclockwise-locked form of the Salmonella enterica Typhimurium flagellar C-ring. Deposited 2023-10-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8UMX Cryo-EM structure of a single subunit of a Clockwise-locked form of the Salmonella enterica Typhimurium flagellar C-ring. Deposited 2023-10-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8UOX Cryo-EM structure of a Counterclockwise locked form of the Salmonella enterica Typhimurium flagellar C-ring, with C34 symmetry applied Deposited 2023-10-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A1 1–560（560 aa） Chain A2 1–560（560 aa） Chain A3 1–560（560 aa） Chain A4 1–560（560 aa） Chain A5 1–560（560 aa） Chain A6 1–560（560 aa） Chain A7 1–560（560 aa） Chain A8 1–560（560 aa） Chain A9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8UPL Cryo-EM structure of a Clockwise locked form of the Salmonella enterica Typhimurium flagellar C-ring, with C34 symmetry applied Deposited 2023-10-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A1 1–560（560 aa） Chain A2 1–560（560 aa） Chain A3 1–560（560 aa） Chain A4 1–560（560 aa） Chain A5 1–560（560 aa） Chain A6 1–560（560 aa） Chain A7 1–560（560 aa） Chain A8 1–560（560 aa） Chain A9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8VIB CW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming single subunit of the C-ring from Salmonella Deposited 2024-01-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8VID CW Flagellar Switch Complex with extra density - FliF, FliG, FliM, and FliN forming single subunit of the C-ring from Salmonella Deposited 2024-01-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8VKQ CW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming the C-ring from Salmonella Deposited 2024-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8VKR CW Flagellar Switch Complex with extra density - FliF, FliG, FliM, and FliN forming the C-ring from Salmonella Deposited 2024-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8WIW Cryo-EM structure of the flagellar C ring in the CW state Deposited 2023-09-25	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 238 PDB declaration: 238-meric	Chain A2 1–560（560 aa） Chain A9 1–560（560 aa） Chain B0 1–560（560 aa） Chain B3 1–560（560 aa） Chain BF 1–560（560 aa） Chain BM 1–560（560 aa） Chain BT 1–560（560 aa） Chain Ba 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bo 1–560（560 aa） Chain Bv 1–560（560 aa） Chain C 1–560（560 aa） Chain CG 1–560（560 aa） Chain CN 1–560（560 aa） Chain CU 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cw 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 5.60 Å
8WJR Cryo-EM structure of the MS ring (C34) within the flagellar motor-hook complex in the CW state Deposited 2023-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 2.90 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain 0 1–560（560 aa） Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain 7 1–560（560 aa） Chain 8 1–560（560 aa） Chain 9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa） Chain t 1–560（560 aa） Chain u 1–560（560 aa） Chain v 1–560（560 aa） Chain w 1–560（560 aa） Chain x 1–560（560 aa） Chain y 1–560（560 aa） Chain z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLI Cryo-EM structure of the MS ring (C34) within the flagellar motor-hook complex in the CCW state Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.20 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain 0 1–560（560 aa） Chain 1 1–560（560 aa） Chain 2 1–560（560 aa） Chain 3 1–560（560 aa） Chain 4 1–560（560 aa） Chain 5 1–560（560 aa） Chain 6 1–560（560 aa） Chain 7 1–560（560 aa） Chain 8 1–560（560 aa） Chain 9 1–560（560 aa） Chain AA 1–560（560 aa） Chain AB 1–560（560 aa） Chain AC 1–560（560 aa） Chain AD 1–560（560 aa） Chain AE 1–560（560 aa） Chain AF 1–560（560 aa） Chain AG 1–560（560 aa） Chain AH 1–560（560 aa） Chain AI 1–560（560 aa） Chain AJ 1–560（560 aa） Chain AK 1–560（560 aa） Chain AL 1–560（560 aa） Chain AM 1–560（560 aa） Chain AN 1–560（560 aa） Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa） Chain t 1–560（560 aa） Chain u 1–560（560 aa） Chain v 1–560（560 aa） Chain w 1–560（560 aa） Chain x 1–560（560 aa） Chain y 1–560（560 aa） Chain z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa） Chain i 1–560（560 aa） Chain j 1–560（560 aa） Chain k 1–560（560 aa） Chain l 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain B6 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain Bb 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bn 1–560（560 aa） Chain Bt 1–560（560 aa） Chain Bz 1–560（560 aa） Chain C3 1–560（560 aa） Chain C7 1–560（560 aa） Chain CB 1–560（560 aa） Chain CH 1–560（560 aa） Chain CN 1–560（560 aa） Chain CT 1–560（560 aa） Chain CZ 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cx 1–560（560 aa） Chain D2 1–560（560 aa） Chain D8 1–560（560 aa） Chain DE 1–560（560 aa） Chain DK 1–560（560 aa） Chain DR 1–560（560 aa） Chain DX 1–560（560 aa） Chain Dd 1–560（560 aa） Chain Dj 1–560（560 aa） Chain Dp 1–560（560 aa） Chain Dv 1–560（560 aa） Chain EF 1–560（560 aa） Chain EL 1–560（560 aa） Chain ER 1–560（560 aa） Chain EX 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Eh 1–560（560 aa） Chain En 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain AO 1–560（560 aa） Chain AP 1–560（560 aa） Chain AQ 1–560（560 aa） Chain AR 1–560（560 aa） Chain AS 1–560（560 aa） Chain AT 1–560（560 aa） Chain AU 1–560（560 aa） Chain AV 1–560（560 aa） Chain AW 1–560（560 aa） Chain AX 1–560（560 aa） Chain AY 1–560（560 aa） Chain AZ 1–560（560 aa） Chain Aa 1–560（560 aa） Chain Ac 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Ae 1–560（560 aa） Chain Af 1–560（560 aa） Chain Ag 1–560（560 aa） Chain Ah 1–560（560 aa） Chain Ai 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ak 1–560（560 aa） Chain Al 1–560（560 aa） Chain Am 1–560（560 aa） Chain An 1–560（560 aa） Chain Ao 1–560（560 aa） Chain Ap 1–560（560 aa） Chain B0 1–560（560 aa） Chain B3 1–560（560 aa） Chain BG 1–560（560 aa） Chain BH 1–560（560 aa） Chain BI 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BK 1–560（560 aa） Chain BL 1–560（560 aa） Chain BM 1–560（560 aa） Chain BN 1–560（560 aa） Chain BO 1–560（560 aa） Chain BP 1–560（560 aa） Chain BQ 1–560（560 aa） Chain BR 1–560（560 aa） Chain BS 1–560（560 aa） Chain BT 1–560（560 aa） Chain BU 1–560（560 aa） Chain BV 1–560（560 aa） Chain BW 1–560（560 aa） Chain BX 1–560（560 aa） Chain Ba 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bo 1–560（560 aa） Chain Bv 1–560（560 aa） Chain CG 1–560（560 aa） Chain CN 1–560（560 aa） Chain CU 1–560（560 aa） Chain Cb 1–560（560 aa） Chain Ci 1–560（560 aa） Chain Cp 1–560（560 aa） Chain Cw 1–560（560 aa） Chain DE 1–560（560 aa） Chain DL 1–560（560 aa） Chain EH 1–560（560 aa） Chain EO 1–560（560 aa） Chain EV 1–560（560 aa） Chain Ea 1–560（560 aa） Chain Eb 1–560（560 aa） Chain Ec 1–560（560 aa） Chain Ed 1–560（560 aa） Chain Ee 1–560（560 aa） Chain Ef 1–560（560 aa） Chain Eg 1–560（560 aa） Chain Eh 1–560（560 aa） Chain Ei 1–560（560 aa） Chain Ej 1–560（560 aa） Chain Ek 1–560（560 aa） Chain El 1–560（560 aa） Chain Em 1–560（560 aa） Chain En 1–560（560 aa） Chain Eo 1–560（560 aa） Chain Ep 1–560（560 aa） Chain UI 1–560（560 aa） Chain UJ 1–560（560 aa） Chain UK 1–560（560 aa） Chain UL 1–560（560 aa） Chain UM 1–560（560 aa） Chain UN 1–560（560 aa） Chain UO 1–560（560 aa） Chain UP 1–560（560 aa） Chain WA 1–560（560 aa） Chain WB 1–560（560 aa） Chain WC 1–560（560 aa） Chain WD 1–560（560 aa） Chain WE 1–560（560 aa） Chain WF 1–560（560 aa） Chain WG 1–560（560 aa） Chain WH 1–560（560 aa） Chain WI 1–560（560 aa） Chain WJ 1–560（560 aa） Chain WK 1–560（560 aa） Chain WL 1–560（560 aa） Chain WM 1–560（560 aa） Chain WN 1–560（560 aa） Chain WO 1–560（560 aa） Chain WP 1–560（560 aa） Chain WQ 1–560（560 aa） Chain WR 1–560（560 aa） Chain WS 1–560（560 aa） Chain WT 1–560（560 aa） Chain WU 1–560（560 aa） Chain WV 1–560（560 aa） Chain WW 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
8XP0 Cryo-EM structure of the protomers of the C ring in the CCW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain N 1–560（560 aa） Chain T 1–560（560 aa） Chain Z 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 4.00 Å
8XP1 Cryo-EM structure of the protomers of the C ring in the CW state Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.40 Å
8YJT Cryo-EM structure of the flagellar C ring in the CCW state Deposited 2024-03-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain 0 1–560（560 aa） Chain 4 1–560（560 aa） Chain A2 1–560（560 aa） Chain A8 1–560（560 aa） Chain AF 1–560（560 aa） Chain AL 1–560（560 aa） Chain AR 1–560（560 aa） Chain AX 1–560（560 aa） Chain Ad 1–560（560 aa） Chain Aj 1–560（560 aa） Chain Ap 1–560（560 aa） Chain Av 1–560（560 aa） Chain B6 1–560（560 aa） Chain BD 1–560（560 aa） Chain BJ 1–560（560 aa） Chain BP 1–560（560 aa） Chain BV 1–560（560 aa） Chain Bb 1–560（560 aa） Chain Bh 1–560（560 aa） Chain Bn 1–560（560 aa） Chain Bt 1–560（560 aa） Chain Bz 1–560（560 aa） Chain CB 1–560（560 aa） Chain CH 1–560（560 aa） Chain CN 1–560（560 aa） Chain CT 1–560（560 aa） Chain CZ 1–560（560 aa） Chain Cf 1–560（560 aa） Chain Cl 1–560（560 aa） Chain Cr 1–560（560 aa） Chain Cx 1–560（560 aa） Chain l 1–560（560 aa） Chain r 1–560（560 aa） Chain x 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 5.90 Å
8ZDS Structure of the Salmonella flagellar MS-ring with C11 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8ZDT Structure of the RBM3 ring of Salmonella flagellar MS-ring protein FliF with C33 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 33 PDB declaration: 33-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8ZDU Structure of the RBM3 ring of Salmonella flagellar MS-ring protein FliF with C34 symmetry applied Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 34 PDB declaration: 34-meric	Chain A 1–560（560 aa） Chain B 1–560（560 aa） Chain C 1–560（560 aa） Chain D 1–560（560 aa） Chain E 1–560（560 aa） Chain F 1–560（560 aa） Chain G 1–560（560 aa） Chain H 1–560（560 aa） Chain I 1–560（560 aa） Chain J 1–560（560 aa） Chain K 1–560（560 aa） Chain L 1–560（560 aa） Chain M 1–560（560 aa） Chain N 1–560（560 aa） Chain O 1–560（560 aa） Chain P 1–560（560 aa） Chain Q 1–560（560 aa） Chain R 1–560（560 aa） Chain S 1–560（560 aa） Chain T 1–560（560 aa） Chain U 1–560（560 aa） Chain V 1–560（560 aa） Chain W 1–560（560 aa） Chain X 1–560（560 aa） Chain Y 1–560（560 aa） Chain Z 1–560（560 aa） Chain a 1–560（560 aa） Chain b 1–560（560 aa） Chain c 1–560（560 aa） Chain d 1–560（560 aa） Chain e 1–560（560 aa） Chain f 1–560（560 aa） Chain g 1–560（560 aa） Chain h 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9N49 C-ring - single subunit of the 34-mer CCW flagellar switch complex - FliF, FliG, FliM, and FliN from Salmonella Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9N4Z CCW Flagellar Switch Complex - FliF, FliG, FliM, and FliN forming 34-mer C-ring from Salmonella Deposited 2025-02-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 204 PDB declaration: 204-meric	Chain A 1–560（560 aa） Chain BC 1–560（560 aa） Chain BF 1–560（560 aa） Chain DB 1–560（560 aa） Chain DE 1–560（560 aa） Chain F 1–560（560 aa） Chain FA 1–560（560 aa） Chain FD 1–560（560 aa） Chain FG 1–560（560 aa） Chain HC 1–560（560 aa） Chain HF 1–560（560 aa） Chain I 1–560（560 aa） Chain JB 1–560（560 aa） Chain JE 1–560（560 aa） Chain LA 1–560（560 aa） Chain LD 1–560（560 aa） Chain LG 1–560（560 aa） Chain NC 1–560（560 aa） Chain NF 1–560（560 aa） Chain PB 1–560（560 aa） Chain PE 1–560（560 aa） Chain RA 1–560（560 aa） Chain RD 1–560（560 aa） Chain RG 1–560（560 aa） Chain S 1–560（560 aa） Chain TC 1–560（560 aa） Chain TF 1–560（560 aa） Chain VB 1–560（560 aa） Chain VE 1–560（560 aa） Chain XA 1–560（560 aa） Chain XD 1–560（560 aa） Chain Z 1–560（560 aa） Chain ZC 1–560（560 aa） Chain ZF 1–560（560 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

47 other PDB entries and 47 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 5； PDBConstruct 1–21； UniProt 311–331 Author chain 6； PDBConstruct 1–21； UniProt 311–331 Author chain 7； PDBConstruct 1–21； UniProt 311–331 Author chain 8； PDBConstruct 1–21； UniProt 311–331 Author chain 9； PDBConstruct 1–21； UniProt 311–331

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain f； UniProt 1–134 Chain g； UniProt 1–134 Chain h； UniProt 1–134 Chain i； UniProt 1–134 Chain j； UniProt 1–134 Chain p； UniProt 1–134	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain f 1–134（134 aa） Chain g 1–134（134 aa） Chain h 1–134（134 aa） Chain i 1–134（134 aa） Chain j 1–134（134 aa） Chain p 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain V 1–134（134 aa） Chain W 1–134（134 aa） Chain X 1–134（134 aa） Chain Y 1–134（134 aa） Chain Z 1–134（134 aa） Chain a 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain BA 1–134（134 aa） Chain BB 1–134（134 aa） Chain BC 1–134（134 aa） Chain BD 1–134（134 aa） Chain BE 1–134（134 aa） Chain BF 1–134（134 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain f； PDBConstruct 1–134； UniProt 1–134 Author chain g； PDBConstruct 1–134； UniProt 1–134 Author chain h； PDBConstruct 1–134； UniProt 1–134 Author chain i； PDBConstruct 1–134； UniProt 1–134 Author chain j； PDBConstruct 1–134； UniProt 1–134 Author chain p； PDBConstruct 1–134； UniProt 1–134

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain k； UniProt 1–138 Chain l； UniProt 1–138 Chain m； UniProt 1–138 Chain n； UniProt 1–138 Chain o； UniProt 1–138	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CG0 Cryo-EM structure of the flagellar proximal rod with FliF peptides from Salmonella Deposited 2020-06-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain k 1–138（138 aa） Chain l 1–138（138 aa） Chain m 1–138（138 aa） Chain n 1–138（138 aa） Chain o 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain o 1–138（138 aa） Chain p 1–138（138 aa） Chain q 1–138（138 aa） Chain r 1–138（138 aa） Chain s 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain Q 1–138（138 aa） Chain R 1–138（138 aa） Chain S 1–138（138 aa） Chain T 1–138（138 aa） Chain U 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain A0 1–138（138 aa） Chain A6 1–138（138 aa） Chain A7 1–138（138 aa） Chain A8 1–138（138 aa） Chain A9 1–138（138 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain k； PDBConstruct 1–138； UniProt 1–138 Author chain l； PDBConstruct 1–138； UniProt 1–138 Author chain m； PDBConstruct 1–138； UniProt 1–138 Author chain n； PDBConstruct 1–138； UniProt 1–138 Author chain o； PDBConstruct 1–138； UniProt 1–138

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain q； UniProt 1–104 Chain r； UniProt 1–104 Chain s； UniProt 1–104 Chain t； UniProt 1–104 Chain u； UniProt 1–104 Chain v； UniProt 1–104	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BIN Salmonella export gate and rod refined in focussed C1 map Deposited 2021-01-12	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
7CG4 Cryo-EM structure of the flagellar export apparatus with FliE from Salmonella Deposited 2020-06-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain a 1–104（104 aa） Chain b 1–104（104 aa） Chain c 1–104（104 aa） Chain d 1–104（104 aa） Chain e 1–104（104 aa） Chain f 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.60 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain q 1–104（104 aa） Chain r 1–104（104 aa） Chain s 1–104（104 aa） Chain t 1–104（104 aa） Chain u 1–104（104 aa） Chain v 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain q 1–104（104 aa） Chain r 1–104（104 aa） Chain s 1–104（104 aa） Chain t 1–104（104 aa） Chain u 1–104（104 aa） Chain v 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WK4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain i 1–104（104 aa） Chain j 1–104（104 aa） Chain k 1–104（104 aa） Chain l 1–104（104 aa） Chain m 1–104（104 aa） Chain n 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.70 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain K 1–104（104 aa） Chain L 1–104（104 aa） Chain M 1–104（104 aa） Chain N 1–104（104 aa） Chain O 1–104（104 aa） Chain P 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain A1 1–104（104 aa） Chain A2 1–104（104 aa） Chain A3 1–104（104 aa） Chain A4 1–104（104 aa） Chain A5 1–104（104 aa） Chain Az 1–104（104 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

15 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain q； PDBConstruct 1–104； UniProt 1–104 Author chain r； PDBConstruct 1–104； UniProt 1–104 Author chain s； PDBConstruct 1–104； UniProt 1–104 Author chain t； PDBConstruct 1–104； UniProt 1–104 Author chain u； PDBConstruct 1–104； UniProt 1–104 Author chain v； PDBConstruct 1–104； UniProt 1–104

Flagellar hook protein FlgE

OrganismNot specified

UniProt P0A1J1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain DA； UniProt 1–403 Chain DB； UniProt 1–403 Chain DC； UniProt 1–403 Chain DD； UniProt 1–403 Chain DE； UniProt 1–403 Chain DF； UniProt 1–403 Chain DG； UniProt 1–403 Chain DH； UniProt 1–403 Chain DI； UniProt 1–403 Chain DJ； UniProt 1–403 Chain DK； UniProt 1–403	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1WLG Crystal structure of FlgE31, a major fragment of the hook protein Deposited 2004-06-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 71–369（299 aa） Fragment：FlgE31 Chain B 71–369（299 aa） Fragment：FlgE31	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；289 K；PEG 2000, copper acetate, cacodylate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 1.80 Å R-free 0.242
3A69 Atomic model of the bacterial flagellar hook based on docking an X-ray derived structure and terminal two alpha-helices into an 7.1 angstrom resolution cryoEM map Deposited 2009-08-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 11 PDB declaration: helical	Chain A 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris-HCl, 100mM NaCl；pH 7；20mM Tris-HCl, 100mM NaCl cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.10 Å
3A69 Atomic model of the bacterial flagellar hook based on docking an X-ray derived structure and terminal two alpha-helices into an 7.1 angstrom resolution cryoEM map Deposited 2009-08-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris-HCl, 100mM NaCl；pH 7；20mM Tris-HCl, 100mM NaCl cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.10 Å
3A69 Atomic model of the bacterial flagellar hook based on docking an X-ray derived structure and terminal two alpha-helices into an 7.1 angstrom resolution cryoEM map Deposited 2009-08-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris-HCl, 100mM NaCl；pH 7；20mM Tris-HCl, 100mM NaCl cryo-EM vitrification conditions Cryogen HELIUM	Resolution 7.10 Å
6K3I Salmonella hook in curved state - 66 subunit models Deposited 2019-05-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 66 PDB declaration: 66-meric	Chain AA 2–403（402 aa） Chain AB 2–403（402 aa） Chain AC 2–403（402 aa） Chain AD 2–403（402 aa） Chain AE 2–403（402 aa） Chain AF 2–403（402 aa） Chain AG 2–403（402 aa） Chain AH 2–403（402 aa） Chain AI 2–403（402 aa） Chain AJ 2–403（402 aa） Chain AK 2–403（402 aa） Chain BA 2–403（402 aa） Chain BB 2–403（402 aa） Chain BC 2–403（402 aa） Chain BD 2–403（402 aa） Chain BE 2–403（402 aa） Chain BF 2–403（402 aa） Chain BG 2–403（402 aa） Chain BH 2–403（402 aa） Chain BI 2–403（402 aa） Chain BJ 2–403（402 aa） Chain BK 2–403（402 aa） Chain CA 2–403（402 aa） Chain CB 2–403（402 aa） Chain CC 2–403（402 aa） Chain CD 2–403（402 aa） Chain CE 2–403（402 aa） Chain CF 2–403（402 aa） Chain CG 2–403（402 aa） Chain CH 2–403（402 aa） Chain CI 2–403（402 aa） Chain CJ 2–403（402 aa） Chain CK 2–403（402 aa） Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 3.5 cryo-EM vitrification conditions Cryogen ETHANE；3 second blot, 4.0uL	Resolution 2.86 Å
7CBM Cryo-EM structure of the flagellar distal rod with partial hook from Salmonella Deposited 2020-06-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.20 Å
7CGB Cryo-EM structure of the flagellar hook from Salmonella Deposited 2020-07-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 22 PDB declaration: 22-meric	Chain DL 1–403（403 aa） Chain DM 1–403（403 aa） Chain DN 1–403（403 aa） Chain DO 1–403（403 aa） Chain DP 1–403（403 aa） Chain DQ 1–403（403 aa） Chain DR 1–403（403 aa） Chain DS 1–403（403 aa） Chain DT 1–403（403 aa） Chain DU 1–403（403 aa） Chain DV 1–403（403 aa） Chain DW 1–403（403 aa） Chain DX 1–403（403 aa） Chain DY 1–403（403 aa） Chain DZ 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.40 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa） Chain DL 1–403（403 aa） Chain DM 1–403（403 aa） Chain DN 1–403（403 aa） Chain DO 1–403（403 aa） Chain DP 1–403（403 aa） Chain DQ 1–403（403 aa） Chain DR 1–403（403 aa） Chain DS 1–403（403 aa） Chain DT 1–403（403 aa） Chain DU 1–403（403 aa） Chain DV 1–403（403 aa） Chain DW 1–403（403 aa） Chain DX 1–403（403 aa） Chain DY 1–403（403 aa） Chain DZ 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E82 Cryo-EM structure of the flagellar rod with partial hook from Salmonella Deposited 2021-02-28	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.30 Å
8WKI Cryo-EM structure of the distal rod-hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLP Cryo-EM structure of the distal rod-hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 53 PDB declaration: 53-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain ZF 1–403（403 aa） Chain ZG 1–403（403 aa） Chain ZH 1–403（403 aa） Chain ZI 1–403（403 aa） Chain ZJ 1–403（403 aa） Chain ZK 1–403（403 aa） Chain ZL 1–403（403 aa） Chain ZM 1–403（403 aa） Chain ZN 1–403（403 aa） Chain ZO 1–403（403 aa） Chain ZP 1–403（403 aa） Chain ZQ 1–403（403 aa） Chain ZR 1–403（403 aa） Chain ZS 1–403（403 aa） Chain ZT 1–403（403 aa） Chain ZU 1–403（403 aa） Chain ZV 1–403（403 aa） Chain ZW 1–403（403 aa） Chain ZX 1–403（403 aa） Chain ZY 1–403（403 aa） Chain ZZ 1–403（403 aa） Chain Za 1–403（403 aa） Chain Zb 1–403（403 aa） Chain Zc 1–403（403 aa） Chain Zd 1–403（403 aa） Chain Ze 1–403（403 aa） Chain Zf 1–403（403 aa） Chain Zg 1–403（403 aa） Chain Zh 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9M7B Structure of flagellar hook at 3.14 angstroms resolution,conformation 2. Deposited 2025-03-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 66 PDB declaration: 66-meric	Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa） Chain GA 2–403（402 aa） Chain GB 2–403（402 aa） Chain GC 2–403（402 aa） Chain GD 2–403（402 aa） Chain GE 2–403（402 aa） Chain GF 2–403（402 aa） Chain GG 2–403（402 aa） Chain GH 2–403（402 aa） Chain GI 2–403（402 aa） Chain GJ 2–403（402 aa） Chain GK 2–403（402 aa） Chain HA 2–403（402 aa） Chain HB 2–403（402 aa） Chain HC 2–403（402 aa） Chain HD 2–403（402 aa） Chain HE 2–403（402 aa） Chain HF 2–403（402 aa） Chain HG 2–403（402 aa） Chain HH 2–403（402 aa） Chain HI 2–403（402 aa） Chain HJ 2–403（402 aa） Chain HK 2–403（402 aa） Chain IA 2–403（402 aa） Chain IB 2–403（402 aa） Chain IC 2–403（402 aa） Chain ID 2–403（402 aa） Chain IE 2–403（402 aa） Chain IF 2–403（402 aa） Chain IG 2–403（402 aa） Chain IH 2–403（402 aa） Chain II 2–403（402 aa） Chain IJ 2–403（402 aa） Chain IK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å
9M7Q Structure of flagellar hook at 3.18 angstroms resolution,conformation 1. Deposited 2025-03-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 44 PDB declaration: 44-meric	Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa） Chain GA 2–403（402 aa） Chain GB 2–403（402 aa） Chain GC 2–403（402 aa） Chain GD 2–403（402 aa） Chain GE 2–403（402 aa） Chain GF 2–403（402 aa） Chain GG 2–403（402 aa） Chain GH 2–403（402 aa） Chain GI 2–403（402 aa） Chain GJ 2–403（402 aa） Chain GK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
9M9F Structure of flagellar hook at 3.50 angstroms resolution,conformation 3. Deposited 2025-03-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 44 PDB declaration: 44-meric	Chain DA 2–403（402 aa） Chain DB 2–403（402 aa） Chain DC 2–403（402 aa） Chain DD 2–403（402 aa） Chain DE 2–403（402 aa） Chain DF 2–403（402 aa） Chain DG 2–403（402 aa） Chain DH 2–403（402 aa） Chain DI 2–403（402 aa） Chain DJ 2–403（402 aa） Chain DK 2–403（402 aa） Chain EA 2–403（402 aa） Chain EB 2–403（402 aa） Chain EC 2–403（402 aa） Chain ED 2–403（402 aa） Chain EE 2–403（402 aa） Chain EF 2–403（402 aa） Chain EG 2–403（402 aa） Chain EH 2–403（402 aa） Chain EI 2–403（402 aa） Chain EJ 2–403（402 aa） Chain EK 2–403（402 aa） Chain FA 2–403（402 aa） Chain FB 2–403（402 aa） Chain FC 2–403（402 aa） Chain FD 2–403（402 aa） Chain FE 2–403（402 aa） Chain FF 2–403（402 aa） Chain FG 2–403（402 aa） Chain FH 2–403（402 aa） Chain FI 2–403（402 aa） Chain FJ 2–403（402 aa） Chain FK 2–403（402 aa） Chain GA 2–403（402 aa） Chain GB 2–403（402 aa） Chain GC 2–403（402 aa） Chain GD 2–403（402 aa） Chain GE 2–403（402 aa） Chain GF 2–403（402 aa） Chain GG 2–403（402 aa） Chain GH 2–403（402 aa） Chain GI 2–403（402 aa） Chain GJ 2–403（402 aa） Chain GK 2–403（402 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9U4R Structure of the intial complex in filament assembly at 3.23 angstroms resolution, conformation 2. Deposited 2025-03-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 73 PDB declaration: 73-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa） Chain EH 1–403（403 aa） Chain EI 1–403（403 aa） Chain EJ 1–403（403 aa） Chain EK 1–403（403 aa） Chain FA 1–403（403 aa） Chain FB 1–403（403 aa） Chain FC 1–403（403 aa） Chain FD 1–403（403 aa） Chain FE 1–403（403 aa） Chain FF 1–403（403 aa） Chain FG 1–403（403 aa） Chain FH 1–403（403 aa） Chain FI 1–403（403 aa） Chain FJ 1–403（403 aa） Chain FK 1–403（403 aa） Chain GA 1–403（403 aa） Chain GB 1–403（403 aa） Chain GC 1–403（403 aa） Chain GD 1–403（403 aa） Chain GE 1–403（403 aa） Chain GF 1–403（403 aa） Chain GG 1–403（403 aa） Chain GH 1–403（403 aa） Chain GI 1–403（403 aa） Chain GJ 1–403（403 aa） Chain GK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å
9U7Y Structure of the tip region of the intial complex in bacterial flagellar filament assembly at 3.68 angstroms resolution, conformation 3. Deposited 2025-03-25	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain DA 1–403（403 aa） Chain DB 1–403（403 aa） Chain DC 1–403（403 aa） Chain DD 1–403（403 aa） Chain DE 1–403（403 aa） Chain DF 1–403（403 aa） Chain DG 1–403（403 aa） Chain DH 1–403（403 aa） Chain DI 1–403（403 aa） Chain DJ 1–403（403 aa） Chain DK 1–403（403 aa） Chain EA 1–403（403 aa） Chain EB 1–403（403 aa） Chain EC 1–403（403 aa） Chain ED 1–403（403 aa） Chain EE 1–403（403 aa） Chain EF 1–403（403 aa） Chain EG 1–403（403 aa） Chain EH 1–403（403 aa） Chain EI 1–403（403 aa） Chain EJ 1–403（403 aa） Chain EK 1–403（403 aa） Chain FA 1–403（403 aa） Chain FB 1–403（403 aa） Chain FC 1–403（403 aa） Chain FD 1–403（403 aa） Chain FE 1–403（403 aa） Chain FF 1–403（403 aa） Chain FG 1–403（403 aa） Chain FH 1–403（403 aa） Chain FI 1–403（403 aa） Chain FJ 1–403（403 aa） Chain FK 1–403（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å

20 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLGE_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain DA； PDBConstruct 1–403； UniProt 1–403 Author chain DB； PDBConstruct 1–403； UniProt 1–403 Author chain DC； PDBConstruct 1–403； UniProt 1–403 Author chain DD； PDBConstruct 1–403； UniProt 1–403 Author chain DE； PDBConstruct 1–403； UniProt 1–403 Author chain DF； PDBConstruct 1–403； UniProt 1–403 Author chain DG； PDBConstruct 1–403； UniProt 1–403 Author chain DH； PDBConstruct 1–403； UniProt 1–403 Author chain DI； PDBConstruct 1–403； UniProt 1–403 Author chain DJ； PDBConstruct 1–403； UniProt 1–403 Author chain DK； PDBConstruct 1–403； UniProt 1–403

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain CE； UniProt 1–264	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6F2D A FliPQR complex forms the core of the Salmonella type III secretion system export apparatus. Deposited 2017-11-24	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6R69 Improved map of the FliPQR complex that forms the core of the Salmonella type III secretion system export apparatus. Deposited 2019-03-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CE 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9K29 Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc Deposited 2024-10-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain CE； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain CA； UniProt 1–89 Chain CB； UniProt 1–89 Chain CC； UniProt 1–89 Chain CD； UniProt 1–89	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CA 1–89（89 aa） Chain CB 1–89（89 aa） Chain CC 1–89（89 aa） Chain CD 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9K29 Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc Deposited 2024-10-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–89（89 aa） Chain H 1–89（89 aa） Chain I 1–89（89 aa） Chain J 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain CA； PDBConstruct 1–89； UniProt 1–89 Author chain CB； PDBConstruct 1–89； UniProt 1–89 Author chain CC； PDBConstruct 1–89； UniProt 1–89 Author chain CD； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 77 PDB declaration: 77-meric（77） Consistent with protein copy count	Chain CF； UniProt 1–245 Chain w； UniProt 1–245 Chain x； UniProt 1–245 Chain y； UniProt 1–245 Chain z； UniProt 1–245	Not recorded	Flagellar basal-body rod protein FlgG × 24 （P0A1J3） Flagellar basal-body rod protein FlgF × 5 （P16323） Flagellar MS ring L2 × 5 Flagellar MS ring L1 × 5 （P15928） Flagellar basal-body rod protein FlgC × 6 （P0A1I7） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar hook protein FlgE × 11 （P0A1J1） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E80	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CG4 Cryo-EM structure of the flagellar export apparatus with FliE from Salmonella Deposited 2020-06-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain r 1–245（245 aa） Chain s 1–245（245 aa） Chain t 1–245（245 aa） Chain u 1–245（245 aa） Chain v 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.60 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CF 1–245（245 aa） Chain w 1–245（245 aa） Chain x 1–245（245 aa） Chain y 1–245（245 aa） Chain z 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å
9K29 Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc Deposited 2024-10-17	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–245（245 aa） Chain B 1–245（245 aa） Chain C 1–245（245 aa） Chain D 1–245（245 aa） Chain E 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain CF； PDBConstruct 1–245； UniProt 1–245 Author chain w； PDBConstruct 1–245； UniProt 1–245 Author chain x； PDBConstruct 1–245； UniProt 1–245 Author chain y； PDBConstruct 1–245； UniProt 1–245 Author chain z； PDBConstruct 1–245； UniProt 1–245

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7e80
Deposition date deposition_date	2021-02-28
Structure title title	Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella
Keywords keywords	Flagella, Rod, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	106.30 Å
Forward intensity I(0) i0	38036600000.00
Molecular weight molecular_weight	1629800.0 kDa
Excluded volume excluded_volume	2027100 Å³
Envelope volume envelope_volume	3146100 Å³
Hydration-shell volume shell_volume	269260 Å³
Envelope diameter envelope_diameter	425.9 Å
Shell Rg shell_rg	85.50 Å
Envelope Rg envelope_rg	110.80 Å
Shape Rg shape_rg	106.20 Å
Total Rg total_rg	106.40 Å
Total atoms total_atoms	114468
Residues n_residues	15371
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	285.0 Å
Rg (real space) rg_real	93.61 Å
Rg uncertainty (real space) rg_real_error	1.62 Å
I(0) (real space) i0_real	3.6310e+10
I(0) uncertainty (real space) i0_real_error	7.3360e+08
Rg (reciprocal space) rg_reciprocal	92.17 Å
I(0) (reciprocal space) i0_reciprocal	36930000000.0000
Solution quality estimate total_estimate	0.9029
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	95.0 Å
Skewness Skewness skewness	0.503
Kurtosis Kurtosis kurtosis	-0.429
Angular range angular_range	— – 0.0750 Å⁻¹
Current regularization parameter α current_alpha	0.3816
Highest regularization parameter α highest_alpha	3650000000.0000
Real-space data points n_real_points	16
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.004; Oscil: 0.922; Stabil: 0.995; Sysdev: 1.000; Positv: 1.000; Valcen: 0.980; Smooth: 0.012

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Flagellar basal-body rod protein FlgG
Molecular weight formula_weight	27784.8 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X
Atom count atom_count	114468

MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQTTLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGTSAYTRDGSFQVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMNDTGLESIGENLYIETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAYEINSKAVSTTDQMLQKLTQL

Entity 2 Entity 2 polymer

Description description	Flagellar basal-body rod protein FlgF
Molecular weight formula_weight	26121.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e

MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDVALQQDGWLVVQAADGAEGYTRNGNIQVGPTGQLTIQGHPVIGEGGPITVPEGSEITIAADGTISALNPGDPPNTVAPVGRLKLVKAEGNEVQRSDDGLFRLTAEAQAERGAVLAADPSIRIMSGVLEGSNVKPVEAMTDMIANARRFEMQMKVITSVDENEGRANQLLSMS

Entity 3 Entity 3 polymer

Description description	Flagellar MS ring L2
Molecular weight formula_weight	1294.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4

XXXXXXXXXXXXXXX

Entity 4 Entity 4 polymer

Description description	Flagellar MS ring L1
Molecular weight formula_weight	1998.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6,7,9,8

GVPGALSNQPAPPNEAPIATP

Entity 5 Entity 5 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,g,h,j,p,i

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

Entity 6 Entity 6 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,m,o,k,n

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 7 Entity 7 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,r,s,t,u,v

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 8 Entity 8 polymer

Description description	Flagellar hook protein FlgE
Molecular weight formula_weight	42233.2 kDa
Source method src_method	nat
Copy count entity_count	11

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DA,DB,DC,DD,DE,DF,DG,DH,DI,DJ,DK

MSFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQDFTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGMQLTGYPATGTPPTIQQGANPAPITIPNTLMAAKSTTTASMQINLNSTDPVPSKTPFSVSDADSYNKKGTVTVYDSQGNAHDMNVYFVKTKDNEWAVYTHDSSDPAATAPTTASTTLKFNENGILESGGTVNITTGTINGATAATFSLSFLNSMQQNTGANNIVATNQNGYKPGDLVSYQINNDGTVVGNYSNEQEQVLGQIVLANFANNEGLASQGDNVWAATQASGVALLGTAGSGNFGKLTNGALEASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR

Entity 9 Entity 9 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CE

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 10 Entity 10 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CA,CB,CC,CD

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 11 Entity 11 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w,x,y,z,CF

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.67 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	52714

fit	/app/data/saxs_computation/e8/7e80/7e80.fit
pddf	/app/data/pr_computation/e8/7e80/7e80.pr.out
profile	/app/data/saxs_computation/e8/7e80/7e80.dat

Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar basal-body rod protein FlgG

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgF

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar MS ring L1

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar hook protein FlgE

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)