8wln

Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–560； UniProt 1–560 Author chain 1； PDBConstruct 1–560； UniProt 1–560 Author chain 2； PDBConstruct 1–560； UniProt 1–560 Author chain 3； PDBConstruct 1–560； UniProt 1–560 Author chain 4； PDBConstruct 1–560； UniProt 1–560 Author chain 5； PDBConstruct 1–560； UniProt 1–560 Author chain 6； PDBConstruct 1–560； UniProt 1–560 Author chain 7； PDBConstruct 1–560； UniProt 1–560 Author chain 8； PDBConstruct 1–560； UniProt 1–560 Author chain 9； PDBConstruct 1–560； UniProt 1–560 Author chain AA； PDBConstruct 1–560； UniProt 1–560 Author chain AB； PDBConstruct 1–560； UniProt 1–560 Author chain AC； PDBConstruct 1–560； UniProt 1–560 Author chain AD； PDBConstruct 1–560； UniProt 1–560 Author chain AE； PDBConstruct 1–560； UniProt 1–560 Author chain AF； PDBConstruct 1–560； UniProt 1–560 Author chain AG； PDBConstruct 1–560； UniProt 1–560 Author chain AH； PDBConstruct 1–560； UniProt 1–560 Author chain AI； PDBConstruct 1–560； UniProt 1–560 Author chain AJ； PDBConstruct 1–560； UniProt 1–560 Author chain AK； PDBConstruct 1–560； UniProt 1–560 Author chain AL； PDBConstruct 1–560； UniProt 1–560 Author chain AM； PDBConstruct 1–560； UniProt 1–560 Author chain AN； PDBConstruct 1–560； UniProt 1–560 Author chain AO； PDBConstruct 1–560； UniProt 1–560 Author chain AP； PDBConstruct 1–560； UniProt 1–560 Author chain AQ； PDBConstruct 1–560； UniProt 1–560 Author chain UI； PDBConstruct 1–560； UniProt 1–560 Author chain UJ； PDBConstruct 1–560； UniProt 1–560 Author chain UK； PDBConstruct 1–560； UniProt 1–560 Author chain UL； PDBConstruct 1–560； UniProt 1–560 Author chain UM； PDBConstruct 1–560； UniProt 1–560 Author chain UN； PDBConstruct 1–560； UniProt 1–560 Author chain UO； PDBConstruct 1–560； UniProt 1–560 Author chain UP； PDBConstruct 1–560； UniProt 1–560 Author chain WA； PDBConstruct 1–560； UniProt 1–560 Author chain WB； PDBConstruct 1–560； UniProt 1–560 Author chain WC； PDBConstruct 1–560； UniProt 1–560 Author chain WD； PDBConstruct 1–560； UniProt 1–560 Author chain WE； PDBConstruct 1–560； UniProt 1–560 Author chain WF； PDBConstruct 1–560； UniProt 1–560 Author chain WG； PDBConstruct 1–560； UniProt 1–560 Author chain WH； PDBConstruct 1–560； UniProt 1–560 Author chain WI； PDBConstruct 1–560； UniProt 1–560 Author chain WJ； PDBConstruct 1–560； UniProt 1–560 Author chain WK； PDBConstruct 1–560； UniProt 1–560 Author chain WL； PDBConstruct 1–560； UniProt 1–560 Author chain WM； PDBConstruct 1–560； UniProt 1–560 Author chain WN； PDBConstruct 1–560； UniProt 1–560 Author chain WO； PDBConstruct 1–560； UniProt 1–560 Author chain WP； PDBConstruct 1–560； UniProt 1–560 Author chain WQ； PDBConstruct 1–560； UniProt 1–560 Author chain WR； PDBConstruct 1–560； UniProt 1–560 Author chain WS； PDBConstruct 1–560； UniProt 1–560 Author chain WT； PDBConstruct 1–560； UniProt 1–560 Author chain WU； PDBConstruct 1–560； UniProt 1–560 Author chain WV； PDBConstruct 1–560； UniProt 1–560 Author chain WW； PDBConstruct 1–560； UniProt 1–560 Author chain b； PDBConstruct 1–560； UniProt 1–560 Author chain c； PDBConstruct 1–560； UniProt 1–560 Author chain d； PDBConstruct 1–560； UniProt 1–560 Author chain e； PDBConstruct 1–560； UniProt 1–560 Author chain f； PDBConstruct 1–560； UniProt 1–560 Author chain g； PDBConstruct 1–560； UniProt 1–560 Author chain h； PDBConstruct 1–560； UniProt 1–560 Author chain i； PDBConstruct 1–560； UniProt 1–560 Author chain j； PDBConstruct 1–560； UniProt 1–560 Author chain k； PDBConstruct 1–560； UniProt 1–560 Author chain l； PDBConstruct 1–560； UniProt 1–560 Author chain t； PDBConstruct 1–560； UniProt 1–560 Author chain u； PDBConstruct 1–560； UniProt 1–560 Author chain v； PDBConstruct 1–560； UniProt 1–560 Author chain w； PDBConstruct 1–560； UniProt 1–560 Author chain x； PDBConstruct 1–560； UniProt 1–560 Author chain y； PDBConstruct 1–560； UniProt 1–560 Author chain z； PDBConstruct 1–560； UniProt 1–560

Flagellar hook-basal body complex protein FliE

OrganismNot specified

UniProt P26462

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar M-ring protein × 76 （P15928） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 1–104； UniProt 1–104 Author chain L； PDBConstruct 1–104； UniProt 1–104 Author chain M； PDBConstruct 1–104； UniProt 1–104 Author chain N； PDBConstruct 1–104； UniProt 1–104 Author chain O； PDBConstruct 1–104； UniProt 1–104 Author chain P； PDBConstruct 1–104； UniProt 1–104

Flagellar biosynthetic protein FliQ

OrganismNot specified

UniProt P0A1L5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar M-ring protein × 76 （P15928） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–89； UniProt 1–89 Author chain B； PDBConstruct 1–89； UniProt 1–89 Author chain C； PDBConstruct 1–89； UniProt 1–89 Author chain D； PDBConstruct 1–89； UniProt 1–89

Flagellar biosynthetic protein FliR

OrganismNot specified

UniProt P54702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar M-ring protein × 76 （P15928） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliP

OrganismNot specified

UniProt P54700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar M-ring protein × 76 （P15928） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–245； UniProt 1–245 Author chain G； PDBConstruct 1–245； UniProt 1–245 Author chain H； PDBConstruct 1–245； UniProt 1–245 Author chain I； PDBConstruct 1–245； UniProt 1–245 Author chain J； PDBConstruct 1–245； UniProt 1–245

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar M-ring protein × 76 （P15928） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal-body rod protein FlgC × 6 （P0A1I7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Q； PDBConstruct 1–138； UniProt 1–138 Author chain R； PDBConstruct 1–138； UniProt 1–138 Author chain S； PDBConstruct 1–138； UniProt 1–138 Author chain T； PDBConstruct 1–138； UniProt 1–138 Author chain U； PDBConstruct 1–138； UniProt 1–138

Flagellar basal-body rod protein FlgC

OrganismNot specified

UniProt P0A1I7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 103	Flagellar M-ring protein × 76 （P15928） Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar biosynthetic protein FliQ × 4 （P0A1L5） Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar basal body rod protein FlgB × 5 （P16437）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGC_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain V； PDBConstruct 1–134； UniProt 1–134 Author chain W； PDBConstruct 1–134； UniProt 1–134 Author chain X； PDBConstruct 1–134； UniProt 1–134 Author chain Y； PDBConstruct 1–134； UniProt 1–134 Author chain Z； PDBConstruct 1–134； UniProt 1–134 Author chain a； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wln
Deposition date deposition_date	2023-09-30
Structure title title	Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state
Keywords keywords	Flagellum, Flagellar motor, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wln__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wln__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wln__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	79.19 Å
Rg (electron density)	78.46 Å
Total Rg	78.45 Å
Atom count	99060
Residues	12996
Excluded volume	1758500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wln__assembly_1__model_1`	103-meric （103）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	76

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;0,1,2,3,4,5,6,7,8,9,AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ,UI,UJ,UK,UL,UM,UN,UO,UP,WA,WB,WC,WD,WE,WF,WG,WH,WI,WJ,WK,WL,WM,WN,WO,WP,WQ,WR,WS,WT,WU,WV,WW,t,u,v,w,x,y,z,b,c,d,e,f,g,h,i,j,k,l ;
Atom count atom_count	99060

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

Entity 2 Entity 2 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Entity 4 Entity 4 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	28938.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNP

Entity 5 Entity 5 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,I,J

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

Entity 6 Entity 6 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T,U

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 7 Entity 7 polymer

Description description	Flagellar basal-body rod protein FlgC
Molecular weight formula_weight	13991.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X,Y,Z,a

MALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVDAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11858

Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal-body rod protein FlgC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8wln__assembly_1__model_1

8wln__assembly_1__model_1 | I(q)

8wln__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer