SAXSdb — 6r69

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

Salmonella enterica subsp. enterica

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （A0A0M0QTK6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G5QE81_SALRU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–245； UniProt 1–245 Author chain B； PDBConstruct 1–245； UniProt 1–245 Author chain C； PDBConstruct 1–245； UniProt 1–245 Author chain D； PDBConstruct 1–245； UniProt 1–245 Author chain E； PDBConstruct 1–245； UniProt 1–245

Flagellar biosynthetic protein FliR

Salmonella enterica subsp. enterica serovar Typhimurium

UniProt P54702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Flagellar biosynthetic protein FliP × 5 （G5QE81） Flagellar biosynthetic protein FliQ × 4 （A0A0M0QTK6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

Salmonella enterica

UniProt A0A0M0QTK6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Flagellar biosynthetic protein FliP × 5 （G5QE81） Flagellar biosynthetic protein FliR × 1 （P54702）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M0QTK6_SALER
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–89； UniProt 1–89 Author chain H； PDBConstruct 1–89； UniProt 1–89 Author chain I； PDBConstruct 1–89； UniProt 1–89 Author chain J； PDBConstruct 1–89； UniProt 1–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6r69
Deposition date deposition_date	2019-03-26
Structure title title	Improved map of the FliPQR complex that forms the core of the Salmonella type III secretion system export apparatus.
Keywords keywords	T3SS, Flagella, Cryo-EM, Export, Membrane protein, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6r69__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6r69__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6r69__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.53 Å
Rg (electron density)	35.01 Å
Total Rg	35.78 Å
Atom count	12541
Residues	1629
Excluded volume	233420 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6r69__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26769.0 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	12541

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSFYS

Source Source

Source organism organism	Salmonella enterica subsp. enterica
NCBI taxonomy ID ncbi_taxonomy_id	28901
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	33069.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNPENLYFQGQFGSWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium
NCBI taxonomy ID ncbi_taxonomy_id	28901
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

Source Source

Source organism organism	Salmonella enterica
NCBI taxonomy ID ncbi_taxonomy_id	28901
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.650 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.65 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	97719

Improved map of the FliPQR complex that forms the core of the Salmonella type III secretion system export apparatus.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6r69__assembly_1__model_1

6r69__assembly_1__model_1 | I(q)

6r69__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (2)

Improved map of the FliPQR complex that forms the core of the Salmonella type III secretion system export apparatus.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6r69__assembly_1__model_1

6r69__assembly_1__model_1 | I(q)

6r69__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (2)