SAXSdb — 9k29

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain A； UniProt 1–245 Chain B； UniProt 1–245 Chain C； UniProt 1–245 Chain D； UniProt 1–245 Chain E； UniProt 1–245	Not recorded	Flagellar biosynthetic protein FliR × 1 （P54702） Flagellar biosynthetic protein FliQ × 4 （P0A1L5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9K29	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CG4 Cryo-EM structure of the flagellar export apparatus with FliE from Salmonella Deposited 2020-06-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain r 1–245（245 aa） Chain s 1–245（245 aa） Chain t 1–245（245 aa） Chain u 1–245（245 aa） Chain v 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.60 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CF 1–245（245 aa） Chain w 1–245（245 aa） Chain x 1–245（245 aa） Chain y 1–245（245 aa） Chain z 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain CF 1–245（245 aa） Chain w 1–245（245 aa） Chain x 1–245（245 aa） Chain y 1–245（245 aa） Chain z 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain F 1–245（245 aa） Chain G 1–245（245 aa） Chain H 1–245（245 aa） Chain I 1–245（245 aa） Chain J 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain Au 1–245（245 aa） Chain Av 1–245（245 aa） Chain Aw 1–245（245 aa） Chain Ax 1–245（245 aa） Chain Ay 1–245（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIP_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–245； UniProt 1–245 Author chain B； PDBConstruct 1–245； UniProt 1–245 Author chain C； PDBConstruct 1–245； UniProt 1–245 Author chain D； PDBConstruct 1–245； UniProt 1–245 Author chain E； PDBConstruct 1–245； UniProt 1–245

Flagellar biosynthetic protein FliR

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

UniProt P54702

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain F； UniProt 1–264	Not recorded	Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar biosynthetic protein FliQ × 4 （P0A1L5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9K29	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6F2D A FliPQR complex forms the core of the Salmonella type III secretion system export apparatus. Deposited 2017-11-24	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6R69 Improved map of the FliPQR complex that forms the core of the Salmonella type III secretion system export apparatus. Deposited 2019-03-26	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CE 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain CE 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain E 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain At 1–264（264 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIR_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–264； UniProt 1–264

Flagellar biosynthetic protein FliQ

Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

UniProt P0A1L5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain G； UniProt 1–89 Chain H； UniProt 1–89 Chain I； UniProt 1–89 Chain J； UniProt 1–89	Not recorded	Flagellar biosynthetic protein FliP × 5 （P54700） Flagellar biosynthetic protein FliR × 1 （P54702）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9K29	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CGO Cryo-EM structure of the flagellar motor-hook complex from Salmonella Deposited 2020-07-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 219 PDB declaration: 219-meric	Chain CA 1–89（89 aa） Chain CB 1–89（89 aa） Chain CC 1–89（89 aa） Chain CD 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.90 Å
7E80 Cryo-EM structure of the flagellar rod with hook and export apparatus from Salmonella Deposited 2021-02-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 77 PDB declaration: 77-meric	Chain CA 1–89（89 aa） Chain CB 1–89（89 aa） Chain CC 1–89（89 aa） Chain CD 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 6 seconds before plunging	Resolution 3.67 Å
8WK3 Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CW state Deposited 2023-09-26	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKK Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.30 Å
8WKQ Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. Deposited 2023-09-28	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.80 Å
8WL2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state. Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 3.40 Å
8WLH Cryo-EM structure of the proximal rod-export apparatus and FlgF within the motor-hook complex in the CCW state Deposited 2023-09-29	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.70 Å
8WLN Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 103 PDB declaration: 103-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.30 Å
8WLQ Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state. Deposited 2023-09-30	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 96 PDB declaration: 96-meric	Chain A 1–89（89 aa） Chain B 1–89（89 aa） Chain C 1–89（89 aa） Chain D 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 3.80 Å
8WLT Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CCW state Deposited 2023-10-01	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 213 PDB declaration: 213-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -15 Wait time: 60 Blot total: 1	Resolution 4.10 Å
8WO5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state Deposited 2023-10-06	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 417 PDB declaration: 417-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 2 Blot force: -5 Wait time: 5 Blot total: 1 Drain time: 2	Resolution 7.40 Å
8WOE Cryo-EM structure of the intact flagellar motor-hook complex in the CW state Deposited 2023-10-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 451 PDB declaration: 451-meric	Chain Ab 1–89（89 aa） Chain Aq 1–89（89 aa） Chain Ar 1–89（89 aa） Chain As 1–89（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；Blot time: 4 Blot force: 10 Wait time: 30 Blot total: 1 Drain time: 2	Resolution 4.30 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIQ_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–89； UniProt 1–89 Author chain H； PDBConstruct 1–89； UniProt 1–89 Author chain I； PDBConstruct 1–89； UniProt 1–89 Author chain J； PDBConstruct 1–89； UniProt 1–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9k29
Deposition date deposition_date	2024-10-17
Structure title title	Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc
Keywords keywords	;Bacterial flagellum, flagellar assembly, electron Cryomicroscopy, type III secretion system, Salmonella, PROTEIN TRANSPORT, MOTOR PROTEIN ;; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	36.04 Å
Radius of gyration Rg (electron density) rg_electron	34.60 Å
Forward intensity I(0) i0	415797000.00
Molecular weight molecular_weight	188110.0 kDa
Excluded volume excluded_volume	245530 Å³
Envelope volume envelope_volume	306090 Å³
Hydration-shell volume shell_volume	69217 Å³
Envelope diameter envelope_diameter	120.7 Å
Shell Rg shell_rg	44.12 Å
Envelope Rg envelope_rg	34.22 Å
Shape Rg shape_rg	34.60 Å
Total Rg total_rg	35.36 Å
Total atoms total_atoms	13216
Residues n_residues	1722
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	111.6 Å
Rg (real space) rg_real	35.78 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	4.1580e+08
I(0) uncertainty (real space) i0_real_error	5.8630e+06
Rg (reciprocal space) rg_reciprocal	35.95 Å
I(0) (reciprocal space) i0_reciprocal	415900000.0000
Solution quality estimate total_estimate	0.6793
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	48.2 Å
Skewness Skewness skewness	0.095
Kurtosis Kurtosis kurtosis	-0.381
Angular range angular_range	— – 0.2200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	207400000.0000
Real-space data points n_real_points	45
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.867; Stabil: 1.000; Sysdev: 0.101; Positv: 1.000; Valcen: 0.965; Smooth: 0.958

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthetic protein FliP
Molecular weight formula_weight	26801.1 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	13230

MRRLLFLSLAGLWLFSPAAAAQLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQTREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIASVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS

来源 Source

来源生物 organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Class编号 ncbi_taxonomy_id	99287
宿主生物 host_organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

Entity 2 Entity 2 polymer

Description description	Flagellar biosynthetic protein FliR
Molecular weight formula_weight	30320.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPANDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHLNMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIFLNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFCEHLFSEIFNLLADIVSEMPINNNPHHHHHHHHHH

来源 Source

来源生物 organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Class编号 ncbi_taxonomy_id	99287
宿主生物 host_organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

Entity 3 Entity 3 polymer

Description description	Flagellar biosynthetic protein FliQ
Molecular weight formula_weight	9606.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J

MTPESVMMMGTEAMKVALALAAPLLLVALITGLIISILQAATQINEMTLSFIPKIVAVFIAIIVAGPWMLNLLLDYVRTLFSNLPYIIG

来源 Source

来源生物 organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI Class编号 ncbi_taxonomy_id	99287
宿主生物 host_organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	109333

fit	/app/data/saxs_computation/k2/9k29/9k29.fit
pddf	/app/data/pr_computation/k2/9k29/9k29.pr.out
profile	/app/data/saxs_computation/k2/9k29/9k29.dat

Structure of the Salmonella flagellar FliPQR complex reconstituted in the peptidisc

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthetic protein FliP

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliR

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar biosynthetic protein FliQ

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)