SAXSdb — 8wk4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-basal body complex protein FliE

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Flagellar basal body rod protein FlgB × 5 （P16437） Flagellar M-ring protein × 34 （P15928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIE_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain i； PDBConstruct 1–104； UniProt 1–104 Author chain j； PDBConstruct 1–104； UniProt 1–104 Author chain k； PDBConstruct 1–104； UniProt 1–104 Author chain l； PDBConstruct 1–104； UniProt 1–104 Author chain m； PDBConstruct 1–104； UniProt 1–104 Author chain n； PDBConstruct 1–104； UniProt 1–104

Flagellar basal body rod protein FlgB

OrganismNot specified

UniProt P16437

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar M-ring protein × 34 （P15928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLGB_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain o； PDBConstruct 1–138； UniProt 1–138 Author chain p； PDBConstruct 1–138； UniProt 1–138 Author chain q； PDBConstruct 1–138； UniProt 1–138 Author chain r； PDBConstruct 1–138； UniProt 1–138 Author chain s； PDBConstruct 1–138； UniProt 1–138

Flagellar M-ring protein

OrganismNot specified

UniProt P15928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	Flagellar hook-basal body complex protein FliE × 6 （P26462） Flagellar basal body rod protein FlgB × 5 （P16437）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLIF_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–560； UniProt 1–560 Author chain B； PDBConstruct 1–560； UniProt 1–560 Author chain C； PDBConstruct 1–560； UniProt 1–560 Author chain D； PDBConstruct 1–560； UniProt 1–560 Author chain E； PDBConstruct 1–560； UniProt 1–560 Author chain F； PDBConstruct 1–560； UniProt 1–560 Author chain G； PDBConstruct 1–560； UniProt 1–560 Author chain H； PDBConstruct 1–560； UniProt 1–560 Author chain I； PDBConstruct 1–560； UniProt 1–560 Author chain J； PDBConstruct 1–560； UniProt 1–560 Author chain K； PDBConstruct 1–560； UniProt 1–560 Author chain L； PDBConstruct 1–560； UniProt 1–560 Author chain M； PDBConstruct 1–560； UniProt 1–560 Author chain N； PDBConstruct 1–560； UniProt 1–560 Author chain O； PDBConstruct 1–560； UniProt 1–560 Author chain P； PDBConstruct 1–560； UniProt 1–560 Author chain Q； PDBConstruct 1–560； UniProt 1–560 Author chain R； PDBConstruct 1–560； UniProt 1–560 Author chain S； PDBConstruct 1–560； UniProt 1–560 Author chain T； PDBConstruct 1–560； UniProt 1–560 Author chain U； PDBConstruct 1–560； UniProt 1–560 Author chain V； PDBConstruct 1–560； UniProt 1–560 Author chain W； PDBConstruct 1–560； UniProt 1–560 Author chain X； PDBConstruct 1–560； UniProt 1–560 Author chain Y； PDBConstruct 1–560； UniProt 1–560 Author chain Z； PDBConstruct 1–560； UniProt 1–560 Author chain a； PDBConstruct 1–560； UniProt 1–560 Author chain b； PDBConstruct 1–560； UniProt 1–560 Author chain c； PDBConstruct 1–560； UniProt 1–560 Author chain d； PDBConstruct 1–560； UniProt 1–560 Author chain e； PDBConstruct 1–560； UniProt 1–560 Author chain f； PDBConstruct 1–560； UniProt 1–560 Author chain g； PDBConstruct 1–560； UniProt 1–560 Author chain h； PDBConstruct 1–560； UniProt 1–560

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wk4
Deposition date deposition_date	2023-09-27
Structure title title	Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state.
Keywords keywords	Flagellum, Flagellar motor, MS ring, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wk4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wk4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wk4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	85.75 Å
Rg (electron density)	86.61 Å
Total Rg	86.70 Å
Atom count	44690
Residues	5771
Excluded volume	780910 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wk4__assembly_1__model_1`	45-meric （45）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar hook-basal body complex protein FliE
Molecular weight formula_weight	11087.7 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,j,k,l,m,n
Atom count atom_count	44690

MAAIQGIEGVISQLQATAMAARGQDTHSQSTVSFAGQLHAALDRISDRQAAARVQAEKFTLGEPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

Entity 2 Entity 2 polymer

Description description	Flagellar basal body rod protein FlgB
Molecular weight formula_weight	15145.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,p,q,r,s

MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN

Entity 3 Entity 3 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	61295.6 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h

MSATASTATQPKPLEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELPFWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVRQETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVALVIRQWMSNDHE

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	24190

Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8wk4__assembly_1__model_1

8wk4__assembly_1__model_1 | I(q)

8wk4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar hook-basal body complex protein FliE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar basal body rod protein FlgB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8wk4__assembly_1__model_1

8wk4__assembly_1__model_1 | I(q)

8wk4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)