SAXSdb — 6dmx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BZIP factor

Human T-lymphotropic virus 1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Transcriptional activator Myb × 2 （P06876） CREB-binding protein × 2 （P45481）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Transcriptional activator Myb × 2 （P06876） CREB-binding protein × 2 （P45481）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2Q067_9DELA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 5–58； UniProt 3–56 Author chain J； PDBConstruct 5–58； UniProt 3–56

Transcriptional activator Myb

Mus musculus

UniProt P06876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	BZIP factor × 1 （Q2Q067） CREB-binding protein × 2 （P45481）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	BZIP factor × 1 （Q2Q067） CREB-binding protein × 2 （P45481）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MYB_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–32； UniProt 284–315 Author chain C； PDBConstruct 1–32； UniProt 284–315 Author chain F； PDBConstruct 1–32； UniProt 284–315 Author chain H； PDBConstruct 1–32； UniProt 284–315

CREB-binding protein

Mus musculus

UniProt P45481

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	BZIP factor × 1 （Q2Q067） Transcriptional activator Myb × 2 （P06876）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	BZIP factor × 1 （Q2Q067） Transcriptional activator Myb × 2 （P06876）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CBP_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 2–88； UniProt 586–672 Author chain D； PDBConstruct 2–88； UniProt 586–672 Author chain G； PDBConstruct 2–88； UniProt 586–672 Author chain I； PDBConstruct 2–88； UniProt 586–672

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6dmx
Deposition date deposition_date	2018-06-05
Structure title title	HBZ56 in complex with KIX and c-Myb
Keywords keywords	transcription coactivator, transcription factor, viral, eukaryotic, complex, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6dmx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6dmx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6dmx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.76 Å
Rg (electron density)	25.00 Å
Total Rg	25.59 Å
Atom count	2130
Residues	258
Excluded volume	37816 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6dmx__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6dmx__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	BZIP factor
Molecular weight formula_weight	6300.0 kDa
Mutation mutation	C9A, C14A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,J
Atom count atom_count	4187

GSHMASGLFRALPVSAPEDLLVEELVDGLLSLEEELKDKEEEKAVLDGLLSLEEESRG

Source Source

Source organism organism	Human T-lymphotropic virus 1
NCBI taxonomy ID ncbi_taxonomy_id	11908
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Transcriptional activator Myb
Molecular weight formula_weight	3810.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A,H,F

YNDEDPEKEKRIKELELLLMSTENELKGQQAL

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	CREB-binding protein
Molecular weight formula_weight	10485.1 kDa
EC 编号 ec_number	2.3.1.48
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,B,I,G

MGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6dmxb_
Class class	a — All alpha proteins
Fold Fold fold	a.12 — Kix domain of CBP (creb binding protein)
Superfamily Superfamily superfamily	a.12.1 — Kix domain of CBP (creb binding protein)
Family Family family	a.12.1.1 — Kix domain of CBP (creb binding protein)

Domain ID domain_id	d6dmxd_
Class class	a — All alpha proteins
Fold Fold fold	a.12 — Kix domain of CBP (creb binding protein)
Superfamily Superfamily superfamily	a.12.1 — Kix domain of CBP (creb binding protein)
Family Family family	a.12.1.1 — Kix domain of CBP (creb binding protein)

Domain ID domain_id	d6dmxg_
Class class	a — All alpha proteins
Fold Fold fold	a.12 — Kix domain of CBP (creb binding protein)
Superfamily Superfamily superfamily	a.12.1 — Kix domain of CBP (creb binding protein)
Family Family family	a.12.1.1 — Kix domain of CBP (creb binding protein)

Domain ID domain_id	d6dmxi_
Class class	a — All alpha proteins
Fold Fold fold	a.12 — Kix domain of CBP (creb binding protein)
Superfamily Superfamily superfamily	a.12.1 — Kix domain of CBP (creb binding protein)
Family Family family	a.12.1.1 — Kix domain of CBP (creb binding protein)

CATH v4.4 (4 domains)

Domain ID domain_id	6dmxB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	246 — Serum Albumin; Chain A, Domain 1
Homologous superfamily homologous superfamily	20 — Coactivator CBP, KIX domain

Domain ID domain_id	6dmxD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	246 — Serum Albumin; Chain A, Domain 1
Homologous superfamily homologous superfamily	20 — Coactivator CBP, KIX domain

Domain ID domain_id	6dmxG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	246 — Serum Albumin; Chain A, Domain 1
Homologous superfamily homologous superfamily	20 — Coactivator CBP, KIX domain

Domain ID domain_id	6dmxI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	246 — Serum Albumin; Chain A, Domain 1
Homologous superfamily homologous superfamily	20 — Coactivator CBP, KIX domain

▶

Unit-cell length a length_a	54.997 Å
Unit-cell length b length_b	80.311 Å
Unit-cell length c length_c	64.641 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.60 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	40.970 Å
R factor r_factor	0.2420
R_work r_work	0.2387
R_free r_free	0.3008

HBZ56 in complex with KIX and c-Myb

1. Protein Identity and Related Structures Protein Identity & Related Structures

BZIP factor

State in the Current Structure

Other States of the Same Protein in the Database

Transcriptional activator Myb

State in the Current Structure

Other States of the Same Protein in the Database

CREB-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6dmx__assembly_1__model_1

6dmx__assembly_1__model_1 | I(q)

6dmx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

HBZ56 in complex with KIX and c-Myb

1. Protein Identity and Related Structures Protein Identity & Related Structures

BZIP factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcriptional activator Myb

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CREB-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6dmx__assembly_1__model_1

6dmx__assembly_1__model_1 | I(q)

6dmx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)