6duz

Structure of the periplasmic domains of PrgH and PrgK from the assembled Salmonella type III secretion injectisome needle complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PrgH

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Lipoprotein PrgK × 24 （P41786）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGH_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–392； UniProt 1–392 Author chain B； PDBConstruct 1–392； UniProt 1–392 Author chain C； PDBConstruct 1–392； UniProt 1–392 Author chain D； PDBConstruct 1–392； UniProt 1–392 Author chain E； PDBConstruct 1–392； UniProt 1–392 Author chain F； PDBConstruct 1–392； UniProt 1–392 Author chain G； PDBConstruct 1–392； UniProt 1–392 Author chain H； PDBConstruct 1–392； UniProt 1–392 Author chain I； PDBConstruct 1–392； UniProt 1–392 Author chain J； PDBConstruct 1–392； UniProt 1–392 Author chain K； PDBConstruct 1–392； UniProt 1–392 Author chain L； PDBConstruct 1–392； UniProt 1–392 Author chain M； PDBConstruct 1–392； UniProt 1–392 Author chain N； PDBConstruct 1–392； UniProt 1–392 Author chain O； PDBConstruct 1–392； UniProt 1–392 Author chain P； PDBConstruct 1–392； UniProt 1–392 Author chain Q； PDBConstruct 1–392； UniProt 1–392 Author chain R； PDBConstruct 1–392； UniProt 1–392 Author chain S； PDBConstruct 1–392； UniProt 1–392 Author chain T； PDBConstruct 1–392； UniProt 1–392 Author chain U； PDBConstruct 1–392； UniProt 1–392 Author chain V； PDBConstruct 1–392； UniProt 1–392 Author chain W； PDBConstruct 1–392； UniProt 1–392 Author chain X； PDBConstruct 1–392； UniProt 1–392

Lipoprotein PrgK

OrganismNot specified

UniProt P41786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 48	Protein PrgH × 24 （P41783）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGK_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Y； PDBConstruct 1–252； UniProt 1–252 Author chain Z； PDBConstruct 1–252； UniProt 1–252 Author chain a； PDBConstruct 1–252； UniProt 1–252 Author chain b； PDBConstruct 1–252； UniProt 1–252 Author chain c； PDBConstruct 1–252； UniProt 1–252 Author chain d； PDBConstruct 1–252； UniProt 1–252 Author chain e； PDBConstruct 1–252； UniProt 1–252 Author chain f； PDBConstruct 1–252； UniProt 1–252 Author chain g； PDBConstruct 1–252； UniProt 1–252 Author chain h； PDBConstruct 1–252； UniProt 1–252 Author chain i； PDBConstruct 1–252； UniProt 1–252 Author chain j； PDBConstruct 1–252； UniProt 1–252 Author chain k； PDBConstruct 1–252； UniProt 1–252 Author chain l； PDBConstruct 1–252； UniProt 1–252 Author chain m； PDBConstruct 1–252； UniProt 1–252 Author chain n； PDBConstruct 1–252； UniProt 1–252 Author chain o； PDBConstruct 1–252； UniProt 1–252 Author chain p； PDBConstruct 1–252； UniProt 1–252 Author chain q； PDBConstruct 1–252； UniProt 1–252 Author chain r； PDBConstruct 1–252； UniProt 1–252 Author chain s； PDBConstruct 1–252； UniProt 1–252 Author chain t； PDBConstruct 1–252； UniProt 1–252 Author chain u； PDBConstruct 1–252； UniProt 1–252 Author chain v； PDBConstruct 1–252； UniProt 1–252

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6duz
Deposition date deposition_date	2018-06-22
Structure title title	Structure of the periplasmic domains of PrgH and PrgK from the assembled Salmonella type III secretion injectisome needle complex
Keywords keywords	Type III secretion system, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6duz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6duz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6duz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.79 Å
Rg (electron density)	87.57 Å
Total Rg	87.71 Å
Atom count	72744
Residues	9072
Excluded volume	1288800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6duz__assembly_1__model_1`	48-meric （48）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Protein PrgH
Molecular weight formula_weight	44509.4 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X
Atom count atom_count	72744

METSKEKTITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPWVPEQPEKLETSAKKNEPRFKNGIVAALAGFFILGIGTVGTLWILNSPQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGRSFQYGAEGYIKMSPGHWYFPSPL

Entity 2 Entity 2 polymer

Description description	Lipoprotein PrgK
Molecular weight formula_weight	28245.3 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z,a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v

MIRRYLYTFLLVMTLAGCKDKDLLKGLDQEQANEVIAVLQMHNIEANKIDSGKLGYSITVAEPDFTAAVYWIKTYQLPPRPRVEIAQMFPADSLVSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYDIDAGENGRPPKPVHLSALAVYERGSPLAHQISDIKRFLKNSFADVDYDNISVVLSERSDAQLQAPGTPVKRNSFATSWIVLIILLSVMSAGFGVWYYKNHYARNKKGITADDKAKSSNE

▼

6. Fold Classification (SCOP + CATH) 72 domains

CATH v4.4 (72 domains)

Domain ID domain_id	6duzA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzA03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzB03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzC03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzD03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzE03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzF02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzF03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzG02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzG03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzH01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzH02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzH03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzI01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzI02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzI03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzJ01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzJ02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzJ03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzK02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzK03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzL01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzL02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzL03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzM01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzM02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzM03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzN01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzN02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzN03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzO01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzO02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzO03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzP01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzP02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzP03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzQ01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzQ02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzQ03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzR01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzR02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzR03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzS01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzS02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzS03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzT01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzT02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzT03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzU01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzU02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzU03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzV01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzV02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzV03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzW01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzW02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzW03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

Domain ID domain_id	6duzX01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1780 —

Domain ID domain_id	6duzX02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6duzX03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1770 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	58000

Structure of the periplasmic domains of PrgH and PrgK from the assembled Salmonella type III secretion injectisome needle complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PrgH

State in the Current Structure

Other States of the Same Protein in the Database

Lipoprotein PrgK

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6duz__assembly_1__model_1

6duz__assembly_1__model_1 | I(q)

6duz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 72 domains

CATH v4.4 (72 domains)

7. Citations (1)

Structure of the periplasmic domains of PrgH and PrgK from the assembled Salmonella type III secretion injectisome needle complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PrgH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lipoprotein PrgK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6duz__assembly_1__model_1

6duz__assembly_1__model_1 | I(q)

6duz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 72 domains

CATH v4.4 (72 domains)

7. Citations (1)