7ah9

Substrate-engaged type 3 secretion system needle complex from Salmonella enterica typhimurium - SpaR state 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Surface presentation of antigens protein SpaP

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Type 3 secretion system secretin × 16 （P35672） Lipoprotein PrgK × 24 （P41786） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAP_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1A； PDBConstruct 1–224； UniProt 1–224 Author chain 1B； PDBConstruct 1–224； UniProt 1–224 Author chain 1C； PDBConstruct 1–224； UniProt 1–224 Author chain 1D； PDBConstruct 1–224； UniProt 1–224 Author chain 1E； PDBConstruct 1–224； UniProt 1–224

Surface presentation of antigens protein SpaR

OrganismNot specified

UniProt P40701

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Type 3 secretion system secretin × 16 （P35672） Lipoprotein PrgK × 24 （P41786） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAR_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1F； PDBConstruct 1–263； UniProt 1–263

Surface presentation of antigens protein SpaQ

OrganismNot specified

UniProt P0A1L7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Type 3 secretion system secretin × 16 （P35672） Lipoprotein PrgK × 24 （P41786） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAQ_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 1G； PDBConstruct 1–86； UniProt 1–86 Author chain 1H； PDBConstruct 1–86； UniProt 1–86 Author chain 1I； PDBConstruct 1–86； UniProt 1–86 Author chain 1J； PDBConstruct 1–86； UniProt 1–86

Protein PrgJ

OrganismNot specified

UniProt P41785

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Type 3 secretion system secretin × 16 （P35672） Lipoprotein PrgK × 24 （P41786） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGJ_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 1K； PDBConstruct 1–101； UniProt 1–101 Author chain 1L； PDBConstruct 1–101； UniProt 1–101 Author chain 1M； PDBConstruct 1–101； UniProt 1–101 Author chain 1N； PDBConstruct 1–101； UniProt 1–101 Author chain 1O； PDBConstruct 1–101； UniProt 1–101 Author chain 1P； PDBConstruct 1–101； UniProt 1–101

Protein PrgI

OrganismNot specified

UniProt P41784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Type 3 secretion system secretin × 16 （P35672） Lipoprotein PrgK × 24 （P41786） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGI_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–80； UniProt 1–80 Author chain 2B； PDBConstruct 1–80； UniProt 1–80 Author chain 2C； PDBConstruct 1–80； UniProt 1–80 Author chain 2D； PDBConstruct 1–80； UniProt 1–80 Author chain 2E； PDBConstruct 1–80； UniProt 1–80 Author chain 2F； PDBConstruct 1–80； UniProt 1–80 Author chain 2G； PDBConstruct 1–80； UniProt 1–80 Author chain 2H； PDBConstruct 1–80； UniProt 1–80 Author chain 2I； PDBConstruct 1–80； UniProt 1–80 Author chain 2J； PDBConstruct 1–80； UniProt 1–80 Author chain 2K； PDBConstruct 1–80； UniProt 1–80 Author chain 2L； PDBConstruct 1–80； UniProt 1–80 Author chain 2M； PDBConstruct 1–80； UniProt 1–80 Author chain 2N； PDBConstruct 1–80； UniProt 1–80 Author chain 2O； PDBConstruct 1–80； UniProt 1–80 Author chain 2P； PDBConstruct 1–80； UniProt 1–80 Author chain 2Q； PDBConstruct 1–80； UniProt 1–80 Author chain 2R； PDBConstruct 1–80； UniProt 1–80 Author chain 2S； PDBConstruct 1–80； UniProt 1–80 Author chain 2T； PDBConstruct 1–80； UniProt 1–80 Author chain 2U； PDBConstruct 1–80； UniProt 1–80 Author chain 2V； PDBConstruct 1–80； UniProt 1–80 Author chain 2W； PDBConstruct 1–80； UniProt 1–80 Author chain 2X； PDBConstruct 1–80； UniProt 1–80 Author chain 2Y； PDBConstruct 1–80； UniProt 1–80 Author chain 2Z； PDBConstruct 1–80； UniProt 1–80 Author chain 3A； PDBConstruct 1–80； UniProt 1–80 Author chain 3B； PDBConstruct 1–80； UniProt 1–80 Author chain 3C； PDBConstruct 1–80； UniProt 1–80 Author chain 3D； PDBConstruct 1–80； UniProt 1–80 Author chain 3E； PDBConstruct 1–80； UniProt 1–80 Author chain 3F； PDBConstruct 1–80； UniProt 1–80 Author chain 3G； PDBConstruct 1–80； UniProt 1–80 Author chain 3H； PDBConstruct 1–80； UniProt 1–80 Author chain 3I； PDBConstruct 1–80； UniProt 1–80 Author chain 3J； PDBConstruct 1–80； UniProt 1–80 Author chain 3K； PDBConstruct 1–80； UniProt 1–80 Author chain 3L； PDBConstruct 1–80； UniProt 1–80 Author chain 3M； PDBConstruct 1–80； UniProt 1–80 Author chain 3N； PDBConstruct 1–80； UniProt 1–80 Author chain 3O； PDBConstruct 1–80； UniProt 1–80 Author chain 3P； PDBConstruct 1–80； UniProt 1–80 Author chain 3Q； PDBConstruct 1–80； UniProt 1–80 Author chain 3R； PDBConstruct 1–80； UniProt 1–80 Author chain 3S； PDBConstruct 1–80； UniProt 1–80 Author chain 3T； PDBConstruct 1–80； UniProt 1–80 Author chain 3U； PDBConstruct 1–80； UniProt 1–80 Author chain 3V； PDBConstruct 1–80； UniProt 1–80 Author chain 3W； PDBConstruct 1–80； UniProt 1–80 Author chain 3X； PDBConstruct 1–80； UniProt 1–80 Author chain 3Y； PDBConstruct 1–80； UniProt 1–80 Author chain 3Z； PDBConstruct 1–80； UniProt 1–80 Author chain 4A； PDBConstruct 1–80； UniProt 1–80 Author chain 4B； PDBConstruct 1–80； UniProt 1–80 Author chain 4C； PDBConstruct 1–80； UniProt 1–80 Author chain 4D； PDBConstruct 1–80； UniProt 1–80 Author chain 4E； PDBConstruct 1–80； UniProt 1–80 Author chain 4F； PDBConstruct 1–80； UniProt 1–80 Author chain 4G； PDBConstruct 1–80； UniProt 1–80 Author chain 4H； PDBConstruct 1–80； UniProt 1–80 Author chain 4I； PDBConstruct 1–80； UniProt 1–80 Author chain 4J； PDBConstruct 1–80； UniProt 1–80 Author chain 4K； PDBConstruct 1–80； UniProt 1–80 Author chain 4L； PDBConstruct 1–80； UniProt 1–80 Author chain 4M； PDBConstruct 1–80； UniProt 1–80 Author chain 4N； PDBConstruct 1–80； UniProt 1–80 Author chain 4O； PDBConstruct 1–80； UniProt 1–80 Author chain 4P； PDBConstruct 1–80； UniProt 1–80 Author chain 4Q； PDBConstruct 1–80； UniProt 1–80 Author chain 4R； PDBConstruct 1–80； UniProt 1–80 Author chain 4S； PDBConstruct 1–80； UniProt 1–80 Author chain 4T； PDBConstruct 1–80； UniProt 1–80

Type 3 secretion system secretin

OrganismNot specified

UniProt P35672

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Lipoprotein PrgK × 24 （P41786） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCTC_SALTY
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 5A； PDBConstruct 1–562； UniProt 1–562 Author chain 5B； PDBConstruct 1–562； UniProt 1–562 Author chain 5C； PDBConstruct 1–562； UniProt 1–562 Author chain 5D； PDBConstruct 1–562； UniProt 1–562 Author chain 5E； PDBConstruct 1–562； UniProt 1–562 Author chain 5F； PDBConstruct 1–562； UniProt 1–562 Author chain 5G； PDBConstruct 1–562； UniProt 1–562 Author chain 5H； PDBConstruct 1–562； UniProt 1–562 Author chain 5I； PDBConstruct 1–562； UniProt 1–562 Author chain 5J； PDBConstruct 1–562； UniProt 1–562 Author chain 5K； PDBConstruct 1–562； UniProt 1–562 Author chain 5L； PDBConstruct 1–562； UniProt 1–562 Author chain 5M； PDBConstruct 1–562； UniProt 1–562 Author chain 5N； PDBConstruct 1–562； UniProt 1–562 Author chain 5O； PDBConstruct 1–562； UniProt 1–562 Author chain 5P； PDBConstruct 1–562； UniProt 1–562

Lipoprotein PrgK

OrganismNot specified

UniProt P41786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Type 3 secretion system secretin × 16 （P35672） Protein PrgH × 24 （P41783） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGK_SALTY
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 6A； PDBConstruct 1–252； UniProt 1–252 Author chain 6B； PDBConstruct 1–252； UniProt 1–252 Author chain 6C； PDBConstruct 1–252； UniProt 1–252 Author chain 6D； PDBConstruct 1–252； UniProt 1–252 Author chain 6E； PDBConstruct 1–252； UniProt 1–252 Author chain 6F； PDBConstruct 1–252； UniProt 1–252 Author chain 6G； PDBConstruct 1–252； UniProt 1–252 Author chain 6H； PDBConstruct 1–252； UniProt 1–252 Author chain 6I； PDBConstruct 1–252； UniProt 1–252 Author chain 6J； PDBConstruct 1–252； UniProt 1–252 Author chain 6K； PDBConstruct 1–252； UniProt 1–252 Author chain 6L； PDBConstruct 1–252； UniProt 1–252 Author chain 6M； PDBConstruct 1–252； UniProt 1–252 Author chain 6N； PDBConstruct 1–252； UniProt 1–252 Author chain 6O； PDBConstruct 1–252； UniProt 1–252 Author chain 6P； PDBConstruct 1–252； UniProt 1–252 Author chain 6Q； PDBConstruct 1–252； UniProt 1–252 Author chain 6R； PDBConstruct 1–252； UniProt 1–252 Author chain 6S； PDBConstruct 1–252； UniProt 1–252 Author chain 6T； PDBConstruct 1–252； UniProt 1–252 Author chain 6U； PDBConstruct 1–252； UniProt 1–252 Author chain 6V； PDBConstruct 1–252； UniProt 1–252 Author chain 6W； PDBConstruct 1–252； UniProt 1–252 Author chain 6X； PDBConstruct 1–252； UniProt 1–252

Protein PrgH

OrganismNot specified

UniProt P41783

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 153	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgJ × 6 （P41785） SptP3x-GFP-FLAG × 1 Protein PrgI × 72 （P41784） Type 3 secretion system secretin × 16 （P35672） Lipoprotein PrgK × 24 （P41786） 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 5 LAURYL DIMETHYLAMINE-N-OXIDE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGH_SALTY
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 7A； PDBConstruct 1–392； UniProt 1–392 Author chain 7B； PDBConstruct 1–392； UniProt 1–392 Author chain 7C； PDBConstruct 1–392； UniProt 1–392 Author chain 7D； PDBConstruct 1–392； UniProt 1–392 Author chain 7E； PDBConstruct 1–392； UniProt 1–392 Author chain 7F； PDBConstruct 1–392； UniProt 1–392 Author chain 7G； PDBConstruct 1–392； UniProt 1–392 Author chain 7H； PDBConstruct 1–392； UniProt 1–392 Author chain 7I； PDBConstruct 1–392； UniProt 1–392 Author chain 7J； PDBConstruct 1–392； UniProt 1–392 Author chain 7K； PDBConstruct 1–392； UniProt 1–392 Author chain 7L； PDBConstruct 1–392； UniProt 1–392 Author chain 7M； PDBConstruct 1–392； UniProt 1–392 Author chain 7N； PDBConstruct 1–392； UniProt 1–392 Author chain 7O； PDBConstruct 1–392； UniProt 1–392 Author chain 7P； PDBConstruct 1–392； UniProt 1–392 Author chain 7Q； PDBConstruct 1–392； UniProt 1–392 Author chain 7R； PDBConstruct 1–392； UniProt 1–392 Author chain 7S； PDBConstruct 1–392； UniProt 1–392 Author chain 7T； PDBConstruct 1–392； UniProt 1–392 Author chain 7U； PDBConstruct 1–392； UniProt 1–392 Author chain 7V； PDBConstruct 1–392； UniProt 1–392 Author chain 7W； PDBConstruct 1–392； UniProt 1–392 Author chain 7X； PDBConstruct 1–392； UniProt 1–392

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ah9
Deposition date deposition_date	2020-09-24
Structure title title	Substrate-engaged type 3 secretion system needle complex from Salmonella enterica typhimurium - SpaR state 1
Keywords keywords	T3SS, Export Apparatus, Injectisome, Needle Complex, PROTEIN TRANSPORT, Substrate; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ah9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ah9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ah9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	123.60 Å
Total Rg	123.20 Å
Atom count	399559
Residues	25300
Excluded volume	3564100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ah9__assembly_1__model_1`	153-meric （153）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Surface presentation of antigens protein SpaP
Molecular weight formula_weight	25249.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1A,1B,1C,1D,1E
Atom count atom_count	399559

MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGVALLLSMFVMWPIMHDAYVYFEDEDVTFNDISSLSKHVDEGLDGYRDYLIKYSDRELVQFFENAQLKRQYGEETETVKRDKDEIEKPSIFALLPAYALSEIKSAFKIGFYLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDIAT

Entity 2 Entity 2 polymer

Description description	Surface presentation of antigens protein SpaR
Molecular weight formula_weight	28499.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1F

MFYALYFEIHHLVASAALGFARVAPIFFFLPFLNSGVLSGAPRNAIIILVALGVWPHALNEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDNQRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNECTPSLPPLLTFINQVAQNALVLASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGIAVLIMLLYFSPVLPDNVLRLSFQATGLSSWFYERGATHVLE

Entity 3 Entity 3 polymer

Description description	Surface presentation of antigens protein SpaQ
Molecular weight formula_weight	9363.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1G,1H,1I,1J

MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIFLALAKG

Entity 4 Entity 4 polymer

Description description	Protein PrgJ
Molecular weight formula_weight	10934.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1K,1L,1M,1N,1O,1P

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Entity 5 Entity 5 polymer

Description description	SptP3x-GFP-FLAG
Molecular weight formula_weight	12017.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NCBI taxonomy ID ncbi_taxonomy_id	99287
Host organism host_organism	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

Entity 6 Entity 6 polymer

Description description	Protein PrgI
Molecular weight formula_weight	8864.9 kDa
Source method src_method	nat
Copy count entity_count	72

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;2A,2B,2C,2D,2E,2F,2G,2H,2I,2J,2K,2L,2M,2N,2O,2P,2Q,2R,2S,2T,2U,2V,2W,2X,2Y,2Z,3A,3B,3C,3D,3E,3F,3G,3H,3I,3J,3K,3L,3M,3N,3O,3P,3Q,3R,3S,3T,3U,3V,3W,3X,3Y,3Z,4A,4B,4C,4D,4E,4F,4G,4H,4I,4J,4K,4L,4M,4N,4O,4P,4Q,4R,4S,4T ;

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

Entity 7 Entity 7 polymer

Description description	Type 3 secretion system secretin
Molecular weight formula_weight	61835.6 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5A,5B,5C,5D,5E,5F,5G,5H,5I,5J,5K,5L,5M,5N,5O,5P

MKTHILLARVLACAALVLVTPGYSSEKIPVTGSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQNDGIELGRQKIGVMRLNNTFVGDRTYNLRDQKMVIPGIATAIERLLQGEEQPLGNIVSSEPPAMPAFSANGEKGKAANYAGGMSLQEALKQNAAAGNIKIVAYPDTNSLLVKGTAEQVHFIEMLVKALDVAKRHVELSLWIVDLNKSDLERLGTSWSGSITIGDKLGVSLNQSSISTLDGSRFIAAVNALEEKKQATVVSRPVLLTQENVPAIFDNNRTFYTKLIGERNVALEHVTYGTMIRVLPRFSADGQIEMSLDIEDGNDKTPQSDTTTSVDALPEVGRTLISTIARVPHGKSLLVGGYTRDANTDTVQSIPFLGKLPLIGSLFRYSSKNKSNVVRVFMIEPKEIVDPLTPDASESVNNILKQSGAWSGDDKLQKWVRVYLDRGQEAIK

Entity 8 Entity 8 polymer

Description description	Lipoprotein PrgK
Molecular weight formula_weight	28245.3 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6A,6B,6C,6D,6E,6F,6G,6H,6I,6J,6K,6L,6M,6N,6O,6P,6Q,6R,6S,6T,6U,6V,6W,6X

MIRRYLYTFLLVMTLAGCKDKDLLKGLDQEQANEVIAVLQMHNIEANKIDSGKLGYSITVAEPDFTAAVYWIKTYQLPPRPRVEIAQMFPADSLVSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYDIDAGENGRPPKPVHLSALAVYERGSPLAHQISDIKRFLKNSFADVDYDNISVVLSERSDAQLQAPGTPVKRNSFATSWIVLIILLSVMSAGFGVWYYKNHYARNKKGITADDKAKSSNE

Entity 9 Entity 9 polymer

Description description	Protein PrgH
Molecular weight formula_weight	44509.4 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7A,7B,7C,7D,7E,7F,7G,7H,7I,7J,7K,7L,7M,7N,7O,7P,7Q,7R,7S,7T,7U,7V,7W,7X

METSKEKTITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPWVPEQPEKLETSAKKNEPRFKNGIVAALAGFFILGIGTVGTLWILNSPQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGRSFQYGAEGYIKMSPGHWYFPSPL

Entity 10 Entity 10 non-polymer

Description description	1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
Molecular weight formula_weight	705.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 11 Entity 11 non-polymer

Description description	LAURYL DIMETHYLAMINE-N-OXIDE
Molecular weight formula_weight	229.4 kDa
Source method src_method	syn
Copy count entity_count	9

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	77411

Substrate-engaged type 3 secretion system needle complex from Salmonella enterica typhimurium - SpaR state 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Surface presentation of antigens protein SpaP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein PrgJ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein PrgI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type 3 secretion system secretin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lipoprotein PrgK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein PrgH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ah9__assembly_1__model_1

7ah9__assembly_1__model_1 | I(q)

7ah9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer