SAXSdb — 7rye

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PrgI

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Cell invasion protein SipD × 5 （A0A0C5PQX9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGI_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–80； UniProt 1–80 Author chain B； PDBConstruct 1–80； UniProt 1–80 Author chain C； PDBConstruct 1–80； UniProt 1–80 Author chain D； PDBConstruct 1–80； UniProt 1–80 Author chain E； PDBConstruct 1–80； UniProt 1–80 Author chain G； PDBConstruct 1–80； UniProt 1–80 Author chain H； PDBConstruct 1–80； UniProt 1–80 Author chain I； PDBConstruct 1–80； UniProt 1–80 Author chain J； PDBConstruct 1–80； UniProt 1–80 Author chain K； PDBConstruct 1–80； UniProt 1–80 Author chain L； PDBConstruct 1–80； UniProt 1–80 Author chain M； PDBConstruct 1–80； UniProt 1–80 Author chain N； PDBConstruct 1–80； UniProt 1–80 Author chain P； PDBConstruct 1–80； UniProt 1–80 Author chain Q； PDBConstruct 1–80； UniProt 1–80 Author chain S； PDBConstruct 1–80； UniProt 1–80 Author chain T； PDBConstruct 1–80； UniProt 1–80 Author chain U； PDBConstruct 1–80； UniProt 1–80 Author chain W； PDBConstruct 1–80； UniProt 1–80

Cell invasion protein SipD

OrganismNot specified

UniProt A0A0C5PQX9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Protein PrgI × 19 （P41784）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0C5PQX9_SALTM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 1–343； UniProt 1–343 Author chain O； PDBConstruct 1–343； UniProt 1–343 Author chain R； PDBConstruct 1–343； UniProt 1–343 Author chain V； PDBConstruct 1–343； UniProt 1–343 Author chain X； PDBConstruct 1–343； UniProt 1–343

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7rye
Deposition date deposition_date	2021-08-25
Structure title title	Cryo-EM structure of the needle filament-tip complex of the Salmonella type III secretion injectisome
Keywords keywords	protein secretion, bacterial pathogenesis, organelle assembly, CELL INVASION; CELL INVASION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7rye__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7rye__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7rye__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.62 Å
Rg (electron density)	51.97 Å
Total Rg	51.94 Å
Atom count	19708
Residues	2535
Excluded volume	349760 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7rye__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Protein PrgI
Molecular weight formula_weight	8864.9 kDa
Source method src_method	nat
Copy count entity_count	19

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,G,H,I,J,K,L,M,N,P,Q,S,T,U,W
Atom count atom_count	19708

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

Entity 2 Entity 2 polymer

Description description	Cell invasion protein SipD
Molecular weight formula_weight	37141.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,O,R,V,X

MLNIQNYSASPHPGIVAERPQTPSASEHVETAVVPSTTEHRGTDIISLSQAATKIHQAQQTLQSTPPISEENNDERTLARQQLTSSLNALAKSGVSLSAEQNENLRSAFSAPTSALFSASPMAQPRTTISDAEIWDMVSQNISAIGDSYLGVYENVVAVYTDFYQAFSDILSKMGGWLLPGKDGNTVKLDVTSLKNDLNSLVNKYNQINSNTVLFPAQSGSGVKVATEAEARQWLSELNLPNSCLKSYGSGYVVTVDLTPLQKMVQDIDGLGAPGKDSKLEMDNAKYQAWQSGFKAQEENMKTTLQTLTQKYSNANSLYDNLVKVLSSTISSSLETAKSFLQG

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	27737

Cryo-EM structure of the needle filament-tip complex of the Salmonella type III secretion injectisome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PrgI

State in the Current Structure

Other States of the Same Protein in the Database

Cell invasion protein SipD

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rye__assembly_1__model_1

7rye__assembly_1__model_1 | I(q)

7rye__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Cryo-EM structure of the needle filament-tip complex of the Salmonella type III secretion injectisome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PrgI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell invasion protein SipD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rye__assembly_1__model_1

7rye__assembly_1__model_1 | I(q)

7rye__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)