SAXSdb — 6fhm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer-membrane lipoprotein carrier protein

Escherichia coli (strain K12)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	GLYCEROL × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LOLA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–206； UniProt 22–203 Author chain B； PDBConstruct 25–206； UniProt 22–203

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6fhm
Deposition date deposition_date	2018-01-15
Structure title title	Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA
Keywords keywords	Lipoprotein transport, domain-swapped dimer, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6fhm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6fhm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6fhm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.10 Å
Rg (electron density)	23.16 Å
Total Rg	23.97 Å
Atom count	2987
Residues	378
Excluded volume	52147 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6fhm__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Outer-membrane lipoprotein carrier protein
Molecular weight formula_weight	22917.1 kDa
Mutation mutation	F47E
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3053

MGSSHHHHHHSSGLVPRGSHMASMDAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLENWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Source Source

Source organism organism	Escherichia coli (strain K12)
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	48

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6fhma1
Class class	b — All beta proteins
Fold Fold fold	b.125 — LolA-like prokaryotic lipoproteins and lipoprotein localization factors
Superfamily Superfamily superfamily	b.125.1 — Prokaryotic lipoproteins and lipoprotein localization factors
Family Family family	b.125.1.1 — Outer-membrane lipoproteins carrier protein LolA

Domain ID domain_id	d6fhma2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d6fhmb1
Class class	b — All beta proteins
Fold Fold fold	b.125 — LolA-like prokaryotic lipoproteins and lipoprotein localization factors
Superfamily Superfamily superfamily	b.125.1 — Prokaryotic lipoproteins and lipoprotein localization factors
Family Family family	b.125.1.1 — Outer-membrane lipoproteins carrier protein LolA

Domain ID domain_id	d6fhmb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

Unit-cell length a length_a	61.030 Å
Unit-cell length b length_b	77.600 Å
Unit-cell length c length_c	103.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.390 Å
Low-resolution limit resolution_low	62.110 Å
R factor r_factor	0.2175
R_work r_work	0.2147
R_free r_free	0.2693

Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer-membrane lipoprotein carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6fhm__assembly_1__model_1

6fhm__assembly_1__model_1 | I(q)

6fhm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)

Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer-membrane lipoprotein carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6fhm__assembly_1__model_1

6fhm__assembly_1__model_1 | I(q)

6fhm__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)