SAXSdb — 6h7w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 26-like protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Putative vacuolar protein sorting-associated protein × 8 （G0SH11） Putative vacuolar protein sorting-associated protein × 4 （G0SH11） Putative vacuolar protein sorting-associated protein × 2 （G0SH11） Vacuolar protein sorting-associated protein 29 × 2 （G0RZB5） Vacuolar protein sorting-associated protein 35 × 2 （G0S709）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S0E6_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–292； UniProt 5–296 Author chain J； PDBConstruct 1–292； UniProt 5–296

Putative vacuolar protein sorting-associated protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0SH11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Vacuolar protein sorting-associated protein 26-like protein × 2 （G0S0E6） Vacuolar protein sorting-associated protein 29 × 2 （G0RZB5） Vacuolar protein sorting-associated protein 35 × 2 （G0S709）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SH11_CHATD
Isoform	—
PDB entities	2, 3, 4
Chains and sequence ranges	Author chain A； PDBConstruct 1–368； UniProt 183–550 Author chain B； PDBConstruct 1–368； UniProt 183–550 Author chain E； PDBConstruct 1–368； UniProt 183–550 Author chain F； PDBConstruct 1–368； UniProt 183–550 Author chain G； PDBConstruct 1–368； UniProt 183–550 Author chain H； PDBConstruct 1–368； UniProt 183–550 Author chain N； PDBConstruct 1–368； UniProt 183–550 Author chain P； PDBConstruct 1–368； UniProt 183–550 Author chain D； PDBConstruct 1–129； UniProt 183–311 Author chain K； PDBConstruct 1–129； UniProt 183–311 Author chain L； PDBConstruct 1–129； UniProt 183–311 Author chain V； PDBConstruct 1–129； UniProt 183–311 Author chain M； PDBConstruct 1–220； UniProt 331–550 Author chain O； PDBConstruct 1–220； UniProt 331–550

Vacuolar protein sorting-associated protein 29

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0RZB5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Vacuolar protein sorting-associated protein 26-like protein × 2 （G0S0E6） Putative vacuolar protein sorting-associated protein × 8 （G0SH11） Putative vacuolar protein sorting-associated protein × 4 （G0SH11） Putative vacuolar protein sorting-associated protein × 2 （G0SH11） Vacuolar protein sorting-associated protein 35 × 2 （G0S709）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZB5_CHATD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain S； PDBConstruct 1–193； UniProt 2–194 Author chain T； PDBConstruct 1–193； UniProt 2–194

Vacuolar protein sorting-associated protein 35

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Vacuolar protein sorting-associated protein 26-like protein × 2 （G0S0E6） Putative vacuolar protein sorting-associated protein × 8 （G0SH11） Putative vacuolar protein sorting-associated protein × 4 （G0SH11） Putative vacuolar protein sorting-associated protein × 2 （G0SH11） Vacuolar protein sorting-associated protein 29 × 2 （G0RZB5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S709_CHATD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Q； PDBConstruct 1–846； UniProt 12–857 Author chain R； PDBConstruct 1–846； UniProt 12–857

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6h7w
Deposition date deposition_date	2018-07-31
Structure title title	Model of retromer-Vps5 complex assembled on membrane.
Keywords keywords	retromer, endosome, sorting nexin, BAR, membrane trafficking, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6h7w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6h7w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6h7w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	99.98 Å
Rg (electron density)	101.30 Å
Total Rg	101.00 Å
Atom count	95648
Residues	6188
Excluded volume	893770 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6h7w__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Vacuolar protein sorting-associated protein 26-like protein
Molecular weight formula_weight	34308.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,C
Atom count atom_count	95648

FSTPVDIDIVLADADKRAMVDVKLDKNRREKVPLYMDGESVKGCVTVRPKDGKRLEHTGIKVQFIGTIEMFFDRGNHYEFLSLVQELAAPGELQHPQTFDFNFKNVEKQYESYNGINVKLRYFVRVTVSRRMADVIREKDIWVYSYRIPPELNSSIKMDVGIEDCLHIEFEYSKSKYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETTGVAPNQYNESETLVRFEIMDGSPSRGETIPIRLFLGGFDLTPTFRDVNKKFSTRYYLSLVLIDEDARRYFKQSEIILYRQPPE

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Putative vacuolar protein sorting-associated protein
Molecular weight formula_weight	42060.8 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A,G,E,P,N,H,F

ARPTFHITVGDPHKVGDLATSHIVYSVRTKTTSKAYKQPEFEVKRRYRDFLWLYNTLHSNNPGVVVPPPPEKQAVGRFESNFVESRRAALEKMLNKIAAHPTLQLDADLKLFLESESFNIDVKHKERKEPPLGESKGVFGSLGFGGGGNKFVEQDDWFHDRRVYLDALENQLKALLKAMDNMVAQRKAMAEAAADFSASLHALSTVELSPTLSGPLDALSELQLAIRDVYERQAQQDVLTFGIIIEEYIRLIGSVKQAFSQRQKAFHSWHSAESELMKKKAAQDKLLRQGKTQQDRLNQVNAEVIDAERKVHQARLLFEDMGRLLRSELDRFEREKVEDFKSGVETFLESAVEAQKELIEKWETFLMQ

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Putative vacuolar protein sorting-associated protein
Molecular weight formula_weight	14898.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,K,V,L

ARPTFHITVGDPHKVGDLATSHIVYSVRTKTTSKAYKQPEFEVKRRYRDFLWLYNTLHSNNPGVVVPPPPEKQAVGRFESNFVESRRAALEKMLNKIAAHPTLQLDADLKLFLESESFNIDVKHKERKE

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Putative vacuolar protein sorting-associated protein
Molecular weight formula_weight	25477.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,M

NKFVEQDDWFHDRRVYLDALENQLKALLKAMDNMVAQRKAMAEAAADFSASLHALSTVELSPTLSGPLDALSELQLAIRDVYERQAQQDVLTFGIIIEEYIRLIGSVKQAFSQRQKAFHSWHSAESELMKKKAAQDKLLRQGKTQQDRLNQVNAEVIDAERKVHQARLLFEDMGRLLRSELDRFEREKVEDFKSGVETFLESAVEAQKELIEKWETFLMQ

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Vacuolar protein sorting-associated protein 29
Molecular weight formula_weight	21470.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

AFLILVIGNLHIPDRALDIPPKFKKLLSPGKISQTLCLGNLTDRATYDYLRSISPDLKIVRGRMDVEATSLPLMQVVTHGSLRIGFLEGFTLVSEEPDVLLAEANKLDVDVLCWAGGSHRFECFEYMDKFFVNPGSATGAFTTDWLAEGEEVVPSFCLMDVQGISLTLYVYQLRKDENGTENVAVEKVTYTKP

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Vacuolar protein sorting-associated protein 35
Molecular weight formula_weight	96140.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R

RLLEDALIAVRQQTAMMRKFLDTPGKLMDALKCCSTLVSELRTSSLSPKQYYELYMAVFDALRYLSAHLRENHPVNHLADLYELVQYAGNIIPRLYLMITVGTAYMSIDGAPVKELMKDMMDMSRGVQHPVRGLFLRYYLSGQARDYLPTGDSDGPEGNLQDSINFILTNFVEMNKLWVRLQHQGHSRERDLRTQERRELQLLVGSNIVRLSQLVDLPTYRDSILGPLLEQIVQCRDILAQEYLLEVITQVFPDEYHLHTLDQFLGAVSRLNPHVNVKAIVIGMMNRLSDYAERESQNEPEEDRAKLEEEALAKLLEKTKLGQNSELEPQNGDHPDTEVSSTTDSAQAPSTADSDTTAVNGEEEPVRKRRGIPVNVPLYDIFFDQVQHLVQAQHLPIQDTIALCCSLANLSLNIYPERLDYVDGILAYALAKVKEHANSADLHSQPAQQSLLSLLQSPLRRYVSIFTALSLPTYVSLFQAQTYPTRRAIAGEIVRTLLKNQTLISTPAHLENVLEILKVLIKEGSQPPAGYPGVVQPRARPLETDETMEEQGWLARLVHLIHSDDNDTQFRLLQMTRKAYAEGNERIRTTTPPLITAGLKLARRFKAREHYDDNWSSQSSSLFKFLHSAISTLYTRVNGPGVADLCLRLFCSCGQVADMTEFEEVAYEFFAQAFTVYEESISDSKAQFQAVCVIASALHRTRNFGRENYDTLITKCAQHASKLLRKPDQCRAVYLASHLWWATPIAARGETEDTELYRDGKRVLECLQRALRVADSCMETATSIELFVEILDRYVYYFDQRNESVTTKYLNGLIELIHSNLAGNQQDSASVEASRKHFIQTLEMIQ

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

▶

Resolution resolution	11.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	16037

Model of retromer-Vps5 complex assembled on membrane.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 26-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative vacuolar protein sorting-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 29

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 35

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6h7w__assembly_1__model_1

6h7w__assembly_1__model_1 | I(q)

6h7w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)