SAXSdb — 7blq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 35

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Sorting nexin-3 × 2 （G0S0X3） Vacuolar protein sorting-associated protein 26-like protein × 2 （G0S0E6） The C-terminal portion of Kex2 cargo, fitted with Phi-X-(L/M) sorting motif of hDMT1-II cargo. × 2 2-(BUTANOYLOXY)-1-{[(HYDROXY{[2,3,4,6-TETRAHYDROXY-5-(PHOSPHONOOXY)CYCLOHEXYL]OXY}PHOSPHORYL)OXY]METHYL}ETHYL BUTANOATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S709_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–295； UniProt 12–306 Author chain C； PDBConstruct 1–295； UniProt 12–306

Sorting nexin-3

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S0X3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Vacuolar protein sorting-associated protein 35 × 2 （G0S709） Vacuolar protein sorting-associated protein 26-like protein × 2 （G0S0E6） The C-terminal portion of Kex2 cargo, fitted with Phi-X-(L/M) sorting motif of hDMT1-II cargo. × 2 2-(BUTANOYLOXY)-1-{[(HYDROXY{[2,3,4,6-TETRAHYDROXY-5-(PHOSPHONOOXY)CYCLOHEXYL]OXY}PHOSPHORYL)OXY]METHYL}ETHYL BUTANOATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S0X3_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–116； UniProt 71–186 Author chain L； PDBConstruct 1–116； UniProt 71–186

Vacuolar protein sorting-associated protein 26-like protein

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S0E6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Vacuolar protein sorting-associated protein 35 × 2 （G0S709） Sorting nexin-3 × 2 （G0S0X3） The C-terminal portion of Kex2 cargo, fitted with Phi-X-(L/M) sorting motif of hDMT1-II cargo. × 2 2-(BUTANOYLOXY)-1-{[(HYDROXY{[2,3,4,6-TETRAHYDROXY-5-(PHOSPHONOOXY)CYCLOHEXYL]OXY}PHOSPHORYL)OXY]METHYL}ETHYL BUTANOATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S0E6_CHATD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–292； UniProt 5–296 Author chain J； PDBConstruct 1–292； UniProt 5–296

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7blq
Deposition date deposition_date	2021-01-18
Structure title title	Vps26 dimer region of the fungal membrane-assembled retromer:Grd19 complex.
Keywords keywords	endosomes, coat proteins, membrane trafficking, cargo-sorting, ENDOCYTOSIS; ENDOCYTOSIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7blq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7blq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7blq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.61 Å
Rg (electron density)	59.28 Å
Total Rg	58.99 Å
Atom count	11722
Residues	1426
Excluded volume	209520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7blq__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Vacuolar protein sorting-associated protein 35
Molecular weight formula_weight	34014.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A
Atom count atom_count	11722

RLLEDALIAVRQQTAMMRKFLDTPGKLMDALKCCSTLVSELRTSSLSPKQYYELYMAVFDALRYLSAHLRENHPVNHLADLYELVQYAGNIIPRLYLMITVGTAYMSIDGAPVKELMKDMMDMSRGVQHPVRGLFLRYYLSGQARDYLPTGDSDGPEGNLQDSINFILTNFVEMNKLWVRLQHQGHSRERDLRTQERRELQLLVGSNIVRLSQLVDLPTYRDSILGPLLEQIVQCRDILAQEYLLEVITQVFPDEYHLHTLDQFLGAVSRLNPHVNVKAIVIGMMNRLSDYAERE

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Sorting nexin-3
Molecular weight formula_weight	13525.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,L

PPENFLEIEVRNPQTHGVGRHMYTDYEIVCRTNIPAFKLRQSSVRRRYSDFEYFRDILERESARVTIPPLPGKVFTNRFSDEVIENRRAGLEKFLKIVVGHPLLQTGSKVLAAFVQ

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Vacuolar protein sorting-associated protein 26-like protein
Molecular weight formula_weight	34308.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,F

FSTPVDIDIVLADADKRAMVDVKLDKNRREKVPLYMDGESVKGCVTVRPKDGKRLEHTGIKVQFIGTIEMFFDRGNHYEFLSLVQELAAPGELQHPQTFDFNFKNVEKQYESYNGINVKLRYFVRVTVSRRMADVIREKDIWVYSYRIPPELNSSIKMDVGIEDCLHIEFEYSKSKYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETTGVAPNQYNESETLVRFEIMDGSPSRGETIPIRLFLGGFDLTPTFRDVNKKFSTRYYLSLVLIDEDARRYFKQSEIILYRQPPE

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	The C-terminal portion of Kex2 cargo, fitted with Phi-X-(L/M) sorting motif of hDMT1-II cargo.
Molecular weight formula_weight	1221.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,U

QPELYLLNTM

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	2-(BUTANOYLOXY)-1-{[(HYDROXY{[2,3,4,6-TETRAHYDROXY-5-(PHOSPHONOOXY)CYCLOHEXYL]OXY}PHOSPHORYL)OXY]METHYL}ETHYL BUTANOATE
Molecular weight formula_weight	554.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Resolution resolution	9.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	49886

Vps26 dimer region of the fungal membrane-assembled retromer:Grd19 complex.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 35

State in the Current Structure

Other States of the Same Protein in the Database

Sorting nexin-3

State in the Current Structure

Other States of the Same Protein in the Database

Vacuolar protein sorting-associated protein 26-like protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7blq__assembly_1__model_1

7blq__assembly_1__model_1 | I(q)

7blq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)

Vps26 dimer region of the fungal membrane-assembled retromer:Grd19 complex.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 35

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sorting nexin-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 26-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7blq__assembly_1__model_1

7blq__assembly_1__model_1 | I(q)

7blq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)