6inq

RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome, with foreign DNA (+1 position)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R4Y0_KOMPG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1743； UniProt 1–1743

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt C4QZQ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QZQ7_KOMPG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1227； UniProt 1–1227

RNA polymerase II third largest subunit B44, part of central core

OrganismNot specified

UniProt C4R7L2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R7L2_KOMPG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–304； UniProt 1–304

RNA polymerase II subunit B32

OrganismNot specified

UniProt C4R2U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R2U9_KOMPG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–186； UniProt 1–186

RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R3P8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3P8_KOMPG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–214； UniProt 1–214

RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R1V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R1V1_KOMPG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

RNA polymerase II subunit

OrganismNot specified

UniProt C4R9A1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R9A1_KOMPG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt C4R273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R273_KOMPG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–145； UniProt 1–145

DNA-directed RNA polymerase subunit

OrganismNot specified

UniProt F2QPE6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2QPE6_KOMPC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–115； UniProt 1–115

RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R009_KOMPG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–72； UniProt 1–72

RNA polymerase II subunit B12.5

OrganismNot specified

UniProt C4R3Z5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3Z5_KOMPG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–118； UniProt 1–118

RNA polymerase subunit ABC10-alpha

OrganismNot specified

UniProt F2QMI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2QMI1_KOMPC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–72； UniProt 1–72

Histone H3.3

Homo sapiens

UniProt P84243

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H33_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain a； PDBConstruct 4–139； UniProt 1–136 Author chain e； PDBConstruct 4–139； UniProt 1–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H2A type 1-B/E × 2 （P04908） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain b； PDBConstruct 4–106； UniProt 1–103 Author chain f； PDBConstruct 4–106； UniProt 1–103

Histone H2A type 1-B/E

Homo sapiens

UniProt P04908

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2B type 1-J × 2 （P06899） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1B_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain c； PDBConstruct 4–133； UniProt 1–130 Author chain g； PDBConstruct 4–133； UniProt 1–130

Histone H2B type 1-J

Homo sapiens

UniProt P06899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 20 DNA 4 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （F2QPE6） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit ABC10-alpha × 1 （F2QMI1） ;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ; × 1 DNA (198-MER) × 1 DNA (198-MER) × 1 Histone H3.3 × 2 （P84243） Histone H4 × 2 （P62805） Histone H2A type 1-B/E × 2 （P04908） DNA (31-MER) × 1 DNA (31-MER) × 1 ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1J_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain d； PDBConstruct 4–129； UniProt 1–126 Author chain h； PDBConstruct 4–129； UniProt 1–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6inq
Deposition date deposition_date	2018-10-26
Structure title title	RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome, with foreign DNA (+1 position)
Keywords keywords	nucleosome, chromatin, RNA polymerase, TRANSCRIPTION, TRANSCRIPTION-RNA-DNA complex; TRANSCRIPTION/RNA/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6inq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6inq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6inq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.42 Å
Rg (electron density)	65.95 Å
Total Rg	66.18 Å
Atom count	43547
Residues	4981
Excluded volume	755580 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6inq__assembly_1__model_1`	25-meric （25）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	194107.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	43547

MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGSIDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNPTMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGMKLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVLPVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFHVATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNLELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHKRAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDTFIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLSPKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLHNGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVSRTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGFADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYVDLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPVNLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLFQCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSIEYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELDRARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEEDQMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVMAVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTSRGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMGTGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFSPMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESKEGE

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	139746.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQPAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDMEKSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDLYKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSRLISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDWQMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQEEGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTREIYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISIGSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSGAISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYDDDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLNDTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIAPGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEGLKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKKLMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAAKLLFQELMAMNIAPRLYTERSGVSMRS

Entity 3 Entity 3 polymer

Description description	RNA polymerase II third largest subunit B44, part of central core
Molecular weight formula_weight	34216.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADEFISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIKVSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEYDPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKANQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDYNAPY

Entity 4 Entity 4 polymer

Description description	RNA polymerase II subunit B32
Molecular weight formula_weight	20623.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLIREALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEETCTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNRLEDPYK

Entity 5 Entity 5 polymer

Description description	RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III
Molecular weight formula_weight	24962.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRSETSGRYASYRICL

Entity 6 Entity 6 polymer

Description description	RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III
Molecular weight formula_weight	17803.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGTIKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQIAMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN

Entity 7 Entity 7 polymer

Description description	RNA polymerase II subunit
Molecular weight formula_weight	18802.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGRIIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLVYNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLANSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGLLMCLEGGYKSLASLKQDNLYILIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	13612.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE

Entity 10 Entity 10 polymer

Description description	RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III
Molecular weight formula_weight	8554.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFLRYNPLEKKDFDS

Entity 11 Entity 11 polymer

Description description	RNA polymerase II subunit B12.5
Molecular weight formula_weight	13832.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVAYKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND

Entity 12 Entity 12 polymer

Description description	RNA polymerase subunit ABC10-alpha
Molecular weight formula_weight	7862.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYKARTKRMIQFDAR

Entity 13 Entity 13 polymer

Description description	;RNA (5'-R(PGPUPGPUPCPUPUPGPGPGP*U)-3') ;
Molecular weight formula_weight	3517.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

GUGUCUUGGGU

Entity 14 Entity 14 polymer

Description description	DNA (198-MER)
Molecular weight formula_weight	60870.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACACCCAAGACACCAGGCACGAGACAGAAAAAAACAACGAAAACGGCCACCACCCAAACACACCAAACACAAGAGCTAATTGACTGACGTAAGC

Entity 15 Entity 15 polymer

Description description	DNA (198-MER)
Molecular weight formula_weight	61381.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

GCTTACGTCAGTCTGGCCATCTTTGTGTTTGGTGTGTTTGGGTGGTGGCCGTTTTCGTTGTTTTTTTCTGTCTCGTGCCTGGTGTCTTGGGTGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT

Entity 16 Entity 16 polymer

Description description	Histone H3.3
Molecular weight formula_weight	15643.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,e

GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 17 Entity 17 polymer

Description description	Histone H4
Molecular weight formula_weight	11676.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,f

GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 18 Entity 18 polymer

Description description	Histone H2A type 1-B/E
Molecular weight formula_weight	14447.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,g

GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 19 Entity 19 polymer

Description description	Histone H2B type 1-J
Molecular weight formula_weight	14217.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,h

GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 20 Entity 20 polymer

Description description	DNA (31-MER)
Molecular weight formula_weight	9544.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	0

CCAAGACACCAGGCACGAGACAGAAAAAAAC

Entity 21 Entity 21 polymer

Description description	DNA (31-MER)
Molecular weight formula_weight	9520.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	1

GTTTTTTTCTGTCTCGTGCCTGGTGTCTTGG

Entity 22 Entity 22 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 23 Entity 23 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	28961

RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome, with foreign DNA (+1 position)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II third largest subunit B44, part of central core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit B32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer