SAXSdb — 6jly

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Translation initiation factor eIF-2B subunit alpha

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 1–341 Chain B； UniProt 1–341	Not recorded	Probable translation initiation factor eIF-2B subunit beta × 2 （Q9UT76） Probable translation initiation factor eIF-2B subunit gamma × 2 （P56288） Probable translation initiation factor eIF-2B subunit delta × 2 （Q09924） Probable translation initiation factor eIF-2B subunit epsilon × 2 （P56287） Eukaryotic translation initiation factor 2 subunit alpha × 2 （P20459） PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.50 Å R-free 0.260

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6JLY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B04 Crystal structure of the eukaryotic translation initiation factor 2B from Schizosaccharomyces pombe Deposited 2015-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa）	Not recorded	PO4 PHOSPHATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG200MME, sodium chloride, Na/K phosphate	Resolution 2.99 Å R-free 0.271
6JLZ P-eIF2a - eIF2B complex Deposited 2019-03-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa）	Not recorded	PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.35 Å R-free 0.253

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EI2BA_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–341； UniProt 1–341 Author chain B； PDBConstruct 1–341； UniProt 1–341

Probable translation initiation factor eIF-2B subunit beta

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt Q9UT76

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain C； UniProt 1–393 Chain D； UniProt 1–393	Not recorded	Translation initiation factor eIF-2B subunit alpha × 2 （Q9USP0） Probable translation initiation factor eIF-2B subunit gamma × 2 （P56288） Probable translation initiation factor eIF-2B subunit delta × 2 （Q09924） Probable translation initiation factor eIF-2B subunit epsilon × 2 （P56287） Eukaryotic translation initiation factor 2 subunit alpha × 2 （P20459） PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.50 Å R-free 0.260

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6JLY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B04 Crystal structure of the eukaryotic translation initiation factor 2B from Schizosaccharomyces pombe Deposited 2015-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–393（393 aa） Chain D 1–393（393 aa）	Not recorded	PO4 PHOSPHATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG200MME, sodium chloride, Na/K phosphate	Resolution 2.99 Å R-free 0.271
6JLZ P-eIF2a - eIF2B complex Deposited 2019-03-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–393（393 aa） Chain D 1–393（393 aa）	Not recorded	PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.35 Å R-free 0.253

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EI2BB_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 7–399； UniProt 1–393 Author chain D； PDBConstruct 7–399； UniProt 1–393

Probable translation initiation factor eIF-2B subunit gamma

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt P56288

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain E； UniProt 1–458 Chain F； UniProt 1–458	Not recorded	Translation initiation factor eIF-2B subunit alpha × 2 （Q9USP0） Probable translation initiation factor eIF-2B subunit beta × 2 （Q9UT76） Probable translation initiation factor eIF-2B subunit delta × 2 （Q09924） Probable translation initiation factor eIF-2B subunit epsilon × 2 （P56287） Eukaryotic translation initiation factor 2 subunit alpha × 2 （P20459） PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.50 Å R-free 0.260

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6JLY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B04 Crystal structure of the eukaryotic translation initiation factor 2B from Schizosaccharomyces pombe Deposited 2015-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–458（458 aa） Chain F 1–458（458 aa）	Not recorded	PO4 PHOSPHATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG200MME, sodium chloride, Na/K phosphate	Resolution 2.99 Å R-free 0.271
6JLZ P-eIF2a - eIF2B complex Deposited 2019-03-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 1–458（458 aa） Chain F 1–458（458 aa）	Not recorded	PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.35 Å R-free 0.253

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EI2BG_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–458； UniProt 1–458 Author chain F； PDBConstruct 1–458； UniProt 1–458

Probable translation initiation factor eIF-2B subunit delta

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt Q09924

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain G； UniProt 1–467 Chain H； UniProt 1–467	Not recorded	Translation initiation factor eIF-2B subunit alpha × 2 （Q9USP0） Probable translation initiation factor eIF-2B subunit beta × 2 （Q9UT76） Probable translation initiation factor eIF-2B subunit gamma × 2 （P56288） Probable translation initiation factor eIF-2B subunit epsilon × 2 （P56287） Eukaryotic translation initiation factor 2 subunit alpha × 2 （P20459） PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.50 Å R-free 0.260

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6JLY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B04 Crystal structure of the eukaryotic translation initiation factor 2B from Schizosaccharomyces pombe Deposited 2015-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–467（467 aa） Chain H 1–467（467 aa）	Not recorded	PO4 PHOSPHATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG200MME, sodium chloride, Na/K phosphate	Resolution 2.99 Å R-free 0.271
6JLZ P-eIF2a - eIF2B complex Deposited 2019-03-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 1–467（467 aa） Chain H 1–467（467 aa）	Not recorded	PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.35 Å R-free 0.253

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EI2BD_SCHPO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–467； UniProt 1–467 Author chain H； PDBConstruct 1–467； UniProt 1–467

Probable translation initiation factor eIF-2B subunit epsilon

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt P56287

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain I； UniProt 1–678 Chain J； UniProt 1–678	Not recorded	Translation initiation factor eIF-2B subunit alpha × 2 （Q9USP0） Probable translation initiation factor eIF-2B subunit beta × 2 （Q9UT76） Probable translation initiation factor eIF-2B subunit gamma × 2 （P56288） Probable translation initiation factor eIF-2B subunit delta × 2 （Q09924） Eukaryotic translation initiation factor 2 subunit alpha × 2 （P20459） PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.50 Å R-free 0.260

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6JLY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5B04 Crystal structure of the eukaryotic translation initiation factor 2B from Schizosaccharomyces pombe Deposited 2015-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–678（678 aa） Chain J 1–678（678 aa）	Not recorded	PO4 PHOSPHATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；PEG200MME, sodium chloride, Na/K phosphate	Resolution 2.99 Å R-free 0.271
6JLZ P-eIF2a - eIF2B complex Deposited 2019-03-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–678（678 aa） Chain J 1–678（678 aa）	Not recorded	PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.35 Å R-free 0.253

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EI2BE_SCHPO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–678； UniProt 1–678 Author chain J； PDBConstruct 1–678； UniProt 1–678

Eukaryotic translation initiation factor 2 subunit alpha

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P20459

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain L； UniProt 1–304 Chain M； UniProt 1–304	Not recorded	Translation initiation factor eIF-2B subunit alpha × 2 （Q9USP0） Probable translation initiation factor eIF-2B subunit beta × 2 （Q9UT76） Probable translation initiation factor eIF-2B subunit gamma × 2 （P56288） Probable translation initiation factor eIF-2B subunit delta × 2 （Q09924） Probable translation initiation factor eIF-2B subunit epsilon × 2 （P56287） PO4 PHOSPHATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.50 Å R-free 0.260

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6JLY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1Q46 crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia Deposited 2003-08-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–176（175 aa） Fragment：N-terminal two thirds of eIF2a	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；0.1 M sodium acetate (pH=4.6), 1.8-2.5 M sodium formate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.86 Å R-free 0.236
2A19 PKR kinase domain- eIF2alpha- AMP-PNP complex. Deposited 2005-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 4–176（173 aa） Fragment：eIF2alpha	Mutation：residues 4-175	MG MAGNESIUM ION × 4 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.286
2A1A PKR kinase domain-eIF2alpha Complex Deposited 2005-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 4–176（173 aa）	Mutation：residue 258-551	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8	Resolution 2.80 Å R-free 0.268
3J81 CryoEM structure of a partial yeast 48S preinitiation complex Deposited 2014-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 42-meric	Chain j 1–300（300 aa）	Not recorded	MG MAGNESIUM ION × 81 ZN ZINC ION × 3 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 mM MES-KOH, 40 mM potassium acetate, 10 mM ammonium acetate, 8 mM magnesium acetate, 2 mM DTT；pH 6.5；20 mM MES-KOH, 40 mM potassium acetate, 10 mM ammonium acetate, 8 mM magnesium acetate, 2 mM DTT cryo-EM vitrification conditions Blot for 2.5 seconds before plunging；120 K；Cryogen ETHANE；Blot for 2.5 seconds before plunging into liquid ethane (FEI VITROBOT MARK I)	Resolution 4.00 Å
3JAP Structure of a partial yeast 48S preinitiation complex in closed conformation Deposited 2015-06-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 81 ZN ZINC ION × 4 MET METHIONINE × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 mM MES-KOH, 40 mM potassium acetate, 10 mM ammonium acetate, 8 mM magnesium acetate, 2 mM DTT；pH 6.5；20 mM MES-KOH, 40 mM potassium acetate, 10 mM ammonium acetate, 8 mM magnesium acetate, 2 mM DTT cryo-EM vitrification conditions Blot for 2.5 to 3 seconds before plunging；120 K；Cryogen ETHANE；Blot for 2.5 to 3 seconds before plunging into liquid ethane (FEI VITROBOT MARK I).	Resolution 4.90 Å
6FYX Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain (model C1) Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 117 ZN ZINC ION × 5 MET METHIONINE × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
6FYY Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain (model C2) Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 117 ZN ZINC ION × 5 MET METHIONINE × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.02 Å
6GSM Structure of a partial yeast 48S preinitiation complex in open conformation. Deposited 2018-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain j 3–265（263 aa）	Not recorded	7NO [(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-2-(phosphonooxymethyl)oxolan-3-yl] (2~{S})-2-azanyl-4-methylsulfanyl-butanoate × 1 MG MAGNESIUM ION × 82 ZN ZINC ION × 4 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.15 Å
6GSN Structure of a partial yeast 48S preinitiation complex in closed conformation Deposited 2018-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 47-meric	Chain j 3–265（263 aa）	Not recorded	MG MAGNESIUM ION × 81 ZN ZINC ION × 4 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.75 Å
6I3M eIF2B:eIF2 complex, phosphorylated on eIF2 alpha serine 52. Deposited 2018-11-06	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Mutation：serine 52 to SEP Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：serine 52 to SEP Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；Solutions for sample preparation were made fresh, filter sterilized, and degassed. cryo-EM vitrification conditions Cryogen ETHANE；Blot for 2 seconds before plunging	Resolution 3.93 Å
6I7T eIF2B:eIF2 complex Deposited 2018-11-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；Solutions for sample preparation were made fresh, filter sterilized, and degassed. cryo-EM vitrification conditions Cryogen ETHANE；Blot for 1 second before plunging	Resolution 4.61 Å
6JLZ P-eIF2a - eIF2B complex Deposited 2019-03-07	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain L 1–304（304 aa） Chain M 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	PO4 PHOSPHATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；sodium acetate, sodium citrate, PEG 4000, glycerol	Resolution 3.35 Å R-free 0.253
6QG0 Structure of eIF2B-eIF2 (phosphorylated at Ser51) complex (model 1) Deposited 2019-01-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.15 Å
6QG1 Structure of eIF2B-eIF2 (phosphorylated at Ser51) complex (model 2) Deposited 2019-01-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.25 Å
6QG2 Structure of eIF2B-eIF2 (phosphorylated at Ser51) complex (model A) Deposited 2019-01-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.55 Å
6QG3 Structure of eIF2B-eIF2 (phosphorylated at Ser51) complex (model B) Deposited 2019-01-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.40 Å
6QG5 Structure of eIF2B-eIF2 (phosphorylated at Ser51) complex (model C) Deposited 2019-01-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.10 Å
6QG6 Structure of eIF2B-eIF2 (phosphorylated at Ser51) complex (model D) Deposited 2019-01-10	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain K 1–304（304 aa） Chain L 1–304（304 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.40 Å
8QEL PKR kinase domain- eIF2alpha in complex with compound Deposited 2023-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 4–176（173 aa）	Not recorded	UH3 (3~{Z})-3-[(4-methyl-1~{H}-imidazol-5-yl)methylidene]-2-oxidanylidene-1~{H}-indole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M MOPS pH 7.5, 10% PEG 8000, 0.2 M magnesium acetate	Resolution 2.45 Å R-free 0.278
8RW1 Structure of a yeast 48S-AUC preinitiation complex in closed conformation Deposited 2024-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 41-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 115 ZN ZINC ION × 3 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
8S8D Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-2) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 41-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 116 ZN ZINC ION × 3 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
8S8E Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-3.1) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 43-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 116 ZN ZINC ION × 3 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.85 Å
8S8F Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-3.2) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 42-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 116 ZN ZINC ION × 4 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.95 Å
8S8G Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-2.1) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 41-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 116 ZN ZINC ION × 3 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8S8H Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-2.2) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 38 PDB declaration: 41-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 116 ZN ZINC ION × 3 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8S8I Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-eIF1) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 42-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 117 ZN ZINC ION × 4 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
8S8J Structure of a yeast 48S-AUC preinitiation complex in closed conformation (model py48S-AUC-eIF5) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 39 PDB declaration: 42-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 115 ZN ZINC ION × 4 MET METHIONINE × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8S8K Structure of a yeast 48S-AUC preinitiation complex in swivelled conformation (model py48S-AUC-swiv-eIF1) Deposited 2024-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 40 PDB declaration: 43-meric	Chain j 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 96 ZN ZINC ION × 4 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å

28 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IF2A_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–304； UniProt 1–304 Author chain M； PDBConstruct 1–304； UniProt 1–304

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6jly
Deposition date deposition_date	2019-03-07
Structure title title	eIF2a - eIF2B complex
Keywords keywords	Translation Initiation, TRANSLATION; TRANSLATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	56.12 Å
Radius of gyration Rg (electron density) rg_electron	55.54 Å
Forward intensity I(0) i0	2836850000.00
Molecular weight molecular_weight	452700.0 kDa
Excluded volume excluded_volume	569570 Å³
Envelope volume envelope_volume	830100 Å³
Hydration-shell volume shell_volume	121790 Å³
Envelope diameter envelope_diameter	196.0 Å
Shell Rg shell_rg	59.64 Å
Envelope Rg envelope_rg	55.40 Å
Shape Rg shape_rg	55.53 Å
Total Rg total_rg	55.67 Å
Total atoms total_atoms	31811
Residues n_residues	4044
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	186.4 Å
Rg (real space) rg_real	56.02 Å
Rg uncertainty (real space) rg_real_error	1.52 Å
I(0) (real space) i0_real	2.8370e+09
I(0) uncertainty (real space) i0_real_error	5.3990e+07
Rg (reciprocal space) rg_reciprocal	56.18 Å
I(0) (reciprocal space) i0_reciprocal	2837000000.0000
Solution quality estimate total_estimate	0.8814
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	66.6 Å
Skewness Skewness skewness	0.273
Kurtosis Kurtosis kurtosis	-0.432
Angular range angular_range	— – 0.1400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	275600000.0000
Real-space data points n_real_points	29
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.877; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.990; Smooth: 0.834

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Translation initiation factor eIF-2B subunit alpha
Molecular weight formula_weight	37817.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	31811

MVESDSSGIVRHSQGEFDIVQVYKKFLQDDPEITMPVAAIEALVQLLSRSQAKTISEFMDILQNGSNTLKEGVQNNISLSAGCDIFQRFVTRSLHDVGDFEQCKRHLVENGKLFIQRARACRQRIAHLGYPLIRDGSVILTHGFSRGVAAVLLAAAKRHVRFKVFVTESRPSGSGCLMTRTLKNACIPTCMVLDSAVSFTMNRVDLVLVGAEGVVENGGLINQIGTFQLAVFAKHAHKPFYAVAESHKFVRMFPLSQYDIPFSRPILEFDDPSPETVHPEPEPIPTPSDAIHNELIMNEEQIRNNPTLDVTPPEFVSGLITDLGIIDSKSGVSEELIKLYL

来源 Source

来源生物 organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
通用名 common_name	Fission yeast
NCBI Class编号 ncbi_taxonomy_id	284812
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Probable translation initiation factor eIF-2B subunit beta
Molecular weight formula_weight	43897.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GPISEFMSTINVEHTYPAVSSLIADLKSRKVQGPFAVAVETALVMRQVISQTRWSTVDQLIDTVRAVGSTLVKAQPTEFSCGNIIRRILRLIREEYQELLKTADENEKLIVSSSNSSSPSQKRDIPSNEKLVQSHEPVSVQMYSSMLNLLGRPTLESPTHSKTVGDSRVTGGMDMRAVIISGIQDVIDELDKINTDIEVQSMDHLHSNEIILTQGCSKTVEAFLRFAAKKRKFSVIVAEGFPNNQKGSHAMAKRLAQAGIDTTVISDATIFAIMSRVNKVILGTHAILGNGGLVTYSGAQLVAQAARHHATPVVVCSGIYKLSPVYPYDLESIIQLSSPDKIMSFNEGDLISRAEILNPYYDYIPPDLVDLFITNLGGYPPSYLYRIMNDTYDASDTIL

来源 Source

来源生物 organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
通用名 common_name	Fission yeast
NCBI Class编号 ncbi_taxonomy_id	284812
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Probable translation initiation factor eIF-2B subunit gamma
Molecular weight formula_weight	50551.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MSLYEHAALPLASSPSILGPISGGRNRGNIQLQSIPIEFQAVVFAGFGNSLYPLTGSDALPKALLPIGNKPMLHYPLYWLEAAGFTSAILICMEEAEAHINAWLRSGYEGHMRIHVEAPTILDDSKSSADALRAVSHLIKNDFVCLSCDSIVGLPPYTVLDKFRLDNPSALAVYSPVLKYEHITSQSKEIDAKQLIGIEEKTSRLLYAKSSADVGSDFTFRMSLLWKHPRVTLNTNLSDAHIFVFKHWVIDLIREKESISSIRGDLIPYLVKCQYQKSFTVRENIQRFLSSPNNIDNYDGGLSSQEIKINALIAKDGIICSRANNLPNYFELNKCIAKLTPEQRLVDVTVSERALVGADCMVNEGTTIKDNSNIKKSIIGKNCVIGKGVVVSNSILMDNIVVEDGVRLESCIVASGAQIGAKSKLRECEIGVDHRVEAGRIARGERLVDMEKIETDMD

来源 Source

来源生物 organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
通用名 common_name	Fission yeast
NCBI Class编号 ncbi_taxonomy_id	284812
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Probable translation initiation factor eIF-2B subunit delta
Molecular weight formula_weight	51652.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

MGFSAEQAKKDGKDQSPVSESSSVGGTSPATASSVVSPNEPKLSGKEAKALKKARKQASRRAKAEAAAANNPPGVSEEKKVAIPNKNSNQQKKASKQNPQNSPETDANLQEKKIFEEKQVSIFSHLDWRRRRTTENIPKDIHPAVIRLGLKLANYKIFGSNQRCIDLLKTFKIVIQDYQTPYGTTLSRHLTTHINSQIAYLVSTRPLSISMGNAIRFLKLEISVLDIDLTDDEGKELLLEKIDSYIRDRIIIAGQVIVQAATEKIQDGDVILTYLHSSTVNDVLIHAKNVGKKFRVVVVDSRPEFEGRVCLKLLTEHGIECTYVMISALSYIMQEVTKIFLGGHAMLSNGALYSRAGTSLISLLGHESNVPVIACCESYKFTERIQLDSLVYNELAPGDQLVNMGVDDFEEKPGVLANWKSVKNLKLLSLKYDVTPPRLITVCVCEMGLLPSTSVPAIINEFKQVYA

来源 Source

来源生物 organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
通用名 common_name	Fission yeast
NCBI Class编号 ncbi_taxonomy_id	284812
宿主生物 host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Probable translation initiation factor eIF-2B subunit epsilon
Molecular weight formula_weight	76413.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MPPSKGLNGKLEKPKHALQAIVLSDSYNYRFRPLTLDKPRCLLPLANTPLIEYTFEFLALAGVQEVYVFCCAHAGQIREYIEKSKWNLPSSPFSVNTIVSRESLSVGDALRELDSKQLITSDFILVSGDVVSNVPLNEVLKEHRKRREDDKNAIMTMVVREASPFHRTRARTESSVFVIDKKTSQCVHYQANERGKHYVSMDPEIFNEHEELEVRNDLIDCQIDICSNDVPALFTENFDYQDIRKDFVYGVLTSDLLGKKIHCHVAKENYAARVRSLQTYDAISKDVLSRWVYPFVPDSNLLNQTFSYQRHQIYKEEDVVLARSCIIKARTLIGAYTKVGDASVVANTIIGRNCTIGSNCSIDSAFLWEDVVIGDNCRIGKAILANSVKIGNNCSIEDGAIVAAGVVIGDNTIIEKNKRLTTFESHSQGTLNDPSLVGIGGRGQEYHAEEDSDDEGEFMEASGLIESTNELHLSDSESSETSSSSEEDMEFIPFSARRDSANTINSEDFDEGDFNKEAQQSLERAFEENHQIDIAALELNTLRMAMNANYHEVRSAIVLALLRRIMHLDVSPKEALAKVMTRWGPLLAKLTFSHEEQVDNVLTLQKYCVRLSMTRHFLQLLGYFYQLEIAEENAIQEWYSDPRSSEGELAALRDAGGKQFVDWLNTAESESESEEGSE

来源 Source

来源生物 organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
通用名 common_name	Fission yeast
NCBI Class编号 ncbi_taxonomy_id	284812
宿主生物 host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Eukaryotic translation initiation factor 2 subunit alpha
Molecular weight formula_weight	34763.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M

MSTSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKRLTPQAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSTEQMQVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNITMPPKAVTATEDAELQALLESKELDNRSDSEDDEDESDDE

来源 Source

来源生物 organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
通用名 common_name	;Baker's yeast ;
NCBI Class编号 ncbi_taxonomy_id	559292
宿主生物 host_organism	Escherichia coli

Entity 7 Entity 7 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	8

▼

7. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6jlyA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1070 — Translation initiation factor eIF-2B, N-terminal domain

Domain ID domain_id	6jlyA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10470 — Translation initiation factor eif-2b; domain 2

Domain ID domain_id	6jlyB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1070 — Translation initiation factor eIF-2B, N-terminal domain

Domain ID domain_id	6jlyB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10470 — Translation initiation factor eif-2b; domain 2

Domain ID domain_id	6jlyL01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	6jlyL02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	190 — Translation initiation factor 2; subunit 1; domain 2

Domain ID domain_id	6jlyM01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	6jlyM02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	150 — DNA polymerase; domain 1
Homologous superfamily homologous superfamily	190 — Translation initiation factor 2; subunit 1; domain 2

▶

8. Citations (1)

▶

Unit-cell length a length_a	155.563 Å
Unit-cell length b length_b	207.992 Å
Unit-cell length c length_c	155.595 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.20 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	49.314 Å
R factor r_factor	0.2245
R_work r_work	0.2239
R_free r_free	0.2598

fit	/app/data/saxs_computation/jl/6jly/6jly.fit
pddf	/app/data/pr_computation/jl/6jly/6jly.pr.out
profile	/app/data/saxs_computation/jl/6jly/6jly.dat

eIF2a - eIF2B complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Translation initiation factor eIF-2B subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Probable translation initiation factor eIF-2B subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Probable translation initiation factor eIF-2B subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Probable translation initiation factor eIF-2B subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Probable translation initiation factor eIF-2B subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Eukaryotic translation initiation factor 2 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 non-polymer

7. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)