6mcp

L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

LegK7

Legionella pneumophila subsp. pneumophila

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MOB kinase activator 1A × 1 （Q9H8S9） TETRAETHYLENE GLYCOL × 2 DI(HYDROXYETHYL)ETHER × 9 HEXAETHYLENE GLYCOL × 3 ZINC ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MOB kinase activator 1A × 1 （Q9H8S9） TETRAETHYLENE GLYCOL × 1 DI(HYDROXYETHYL)ETHER × 9 HEXAETHYLENE GLYCOL × 1 ZINC ION × 1 MANGANESE (II) ION × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5ZU83_LEGPH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–523； UniProt 11–530 Author chain C； PDBConstruct 4–523； UniProt 11–530

MOB kinase activator 1A

Homo sapiens

UniProt Q9H8S9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	LegK7 × 1 （Q5ZU83） TETRAETHYLENE GLYCOL × 2 DI(HYDROXYETHYL)ETHER × 9 HEXAETHYLENE GLYCOL × 3 ZINC ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	LegK7 × 1 （Q5ZU83） TETRAETHYLENE GLYCOL × 1 DI(HYDROXYETHYL)ETHER × 9 HEXAETHYLENE GLYCOL × 1 ZINC ION × 1 MANGANESE (II) ION × 1 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MOB1A_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–184； UniProt 33–213 Author chain D； PDBConstruct 4–184； UniProt 33–213

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mcp
Deposition date deposition_date	2018-09-01
Structure title title	L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A
Keywords keywords	translocated effector, Ser/Thr protein kinase, allosteric activation, Hippo pathway, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6mcp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6mcp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6mcp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.20 Å
Rg (electron density)	28.34 Å
Total Rg	29.11 Å
Atom count	5740
Residues	703
Excluded volume	103030 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6mcp__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6mcp__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	LegK7
Molecular weight formula_weight	60684.2 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	11356

SNAKNTMPLVIAYNNAPEDDKIQKLFYLQKINYLLNKTQLNDDLFDWINDAEEGGWLNELAKFSINPNASFFLKGMQFAKAITEEIKNKPEINSSEVNIYHLMQERDQLLKEVEFEKCATRYAEINFLLNELALNDKKTKEIVERQTEILRLVAPKIKAIKGESIDNLPVIPSYKTKELGNHVNNFNFKFTMSGWEAPFVFRVEDRHELGKEQELHSYGVSKYFIEDYSVFMMRFKAEDGSTVYKPVILSQFANQNNLEEIAKQLKDGSPKNIAPRIGYYFVQLTDFCLKLIETHNYHPDIKLNNFLVHNNRVLVSDRKTFTTNDNPLASEILTSPLFAPDEFLKCLLFNKEGDPVGYNRNALWKRMNMPQFMAYQLGMALKQFLILTQLDELPDDFRNPDHSAVSHFKTPSRQIINLSLLVQELTRLDPDKRMTIKQFQTLLNFKNLPPDAFYQKVEEVFPSSQLGIAEDIEALNKVLNSDLKGEALLKQANPVFTKLSKYDPKETRLTRLAEKLAIRCFNN

Source Source

Source organism organism	Legionella pneumophila subsp. pneumophila
NCBI taxonomy ID ncbi_taxonomy_id	272624
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	MOB kinase activator 1A
Molecular weight formula_weight	21669.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

SNAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	TETRAETHYLENE GLYCOL
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	man
Copy count entity_count	18

Entity 5 Entity 5 non-polymer

Description description	HEXAETHYLENE GLYCOL
Molecular weight formula_weight	282.3 kDa
Source method src_method	man
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	109

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6mcpb1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d6mcpb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d6mcpd1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.7 — Mob1/phocein
Family Family family	a.29.7.1 — Mob1/phocein

Domain ID domain_id	d6mcpd2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	6mcpB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	140 — Butyryl-CoA Dehydrogenase, subunit A; domain 3
Homologous superfamily homologous superfamily	30 — MOB kinase activator

Domain ID domain_id	6mcpD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	140 — Butyryl-CoA Dehydrogenase, subunit A; domain 3
Homologous superfamily homologous superfamily	30 — MOB kinase activator

▶

Unit-cell length a length_a	106.860 Å
Unit-cell length b length_b	112.430 Å
Unit-cell length c length_c	155.220 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	105.58 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	48.668 Å
R factor r_factor	0.1962
R_work r_work	0.1943
R_free r_free	0.2333

L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A

1. Protein Identity and Related Structures Protein Identity & Related Structures

LegK7

State in the Current Structure

Other States of the Same Protein in the Database

MOB kinase activator 1A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6mcp__assembly_1__model_1

6mcp__assembly_1__model_1 | I(q)

6mcp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A

1. Protein Identity and Related Structures Protein Identity & Related Structures

LegK7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MOB kinase activator 1A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6mcp__assembly_1__model_1

6mcp__assembly_1__model_1 | I(q)

6mcp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)