6nr9

hTRiC-hPFD Class5

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit alpha

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–534； UniProt 1–534 Author chain I； PDBConstruct 1–534； UniProt 1–534

T-complex protein 1 subunit beta

Homo sapiens

UniProt P78371

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–509； UniProt 16–524 Author chain J； PDBConstruct 1–509； UniProt 16–524

T-complex protein 1 subunit gamma

Homo sapiens

UniProt P49368

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPG_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–513； UniProt 13–525 Author chain K； PDBConstruct 1–513； UniProt 13–525

T-complex protein 1 subunit delta

Homo sapiens

UniProt P50991

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPD_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–514； UniProt 26–539 Author chain L； PDBConstruct 1–514； UniProt 26–539

T-complex protein 1 subunit epsilon

Homo sapiens

UniProt P48643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPE_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–517； UniProt 25–541 Author chain M； PDBConstruct 1–517； UniProt 25–541

T-complex protein 1 subunit zeta

Homo sapiens

UniProt P40227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPZ_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–515； UniProt 11–525 Author chain N； PDBConstruct 1–515； UniProt 11–525

T-complex protein 1 subunit eta

Homo sapiens

UniProt Q99832

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPH_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–514； UniProt 12–525 Author chain O； PDBConstruct 1–514； UniProt 12–525

T-complex protein 1 subunit theta

Homo sapiens

UniProt P50990

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPQ_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–514； UniProt 14–527 Author chain P； PDBConstruct 1–514； UniProt 14–527

Prefoldin subunit 1

Homo sapiens

UniProt O60925

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PFD1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 1； PDBConstruct 1–107； UniProt 12–118

Prefoldin subunit 2

Homo sapiens

UniProt Q9UHV9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PFD2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 2； PDBConstruct 1–103； UniProt 22–124

Prefoldin subunit 3

Homo sapiens

UniProt P61758

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PFD3_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 3； PDBConstruct 1–132； UniProt 49–180

Prefoldin subunit 4

Homo sapiens

UniProt Q9NQP4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 5 × 1 （Q99471） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PFD4_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 4； PDBConstruct 1–104； UniProt 19–122

Prefoldin subunit 5

Homo sapiens

UniProt Q99471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 6 × 1 （O15212）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PFD5_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 5； PDBConstruct 1–127； UniProt 11–137

Prefoldin subunit 6

Homo sapiens

UniProt O15212

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	T-complex protein 1 subunit alpha × 2 （P17987） T-complex protein 1 subunit beta × 2 （P78371） T-complex protein 1 subunit gamma × 2 （P49368） T-complex protein 1 subunit delta × 2 （P50991） T-complex protein 1 subunit epsilon × 2 （P48643） T-complex protein 1 subunit zeta × 2 （P40227） T-complex protein 1 subunit eta × 2 （Q99832） T-complex protein 1 subunit theta × 2 （P50990） Prefoldin subunit 1 × 1 （O60925） Prefoldin subunit 2 × 1 （Q9UHV9） Prefoldin subunit 3 × 1 （P61758） Prefoldin subunit 4 × 1 （Q9NQP4） Prefoldin subunit 5 × 1 （Q99471）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PFD6_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 6； PDBConstruct 1–102； UniProt 13–114

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6nr9
Deposition date deposition_date	2019-01-23
Structure title title	hTRiC-hPFD Class5
Keywords keywords	TRiC/CCT, PFD, CryoEM, Molecular Chaperone, Protein folding, CHAPERONE; CHAPERONE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6nr9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6nr9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6nr9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.09 Å
Rg (electron density)	73.56 Å
Total Rg	73.65 Å
Atom count	68284
Residues	8896
Excluded volume	1225500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6nr9__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	T-complex protein 1 subunit alpha
Molecular weight formula_weight	58061.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,I
Atom count atom_count	68284

MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 2 Entity 2 polymer

Description description	T-complex protein 1 subunit beta
Molecular weight formula_weight	54736.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,J

ADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 3 Entity 3 polymer

Description description	T-complex protein 1 subunit gamma
Molecular weight formula_weight	57165.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,K

NTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 4 Entity 4 polymer

Description description	T-complex protein 1 subunit delta
Molecular weight formula_weight	55636.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,L

DRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 5 Entity 5 polymer

Description description	T-complex protein 1 subunit epsilon
Molecular weight formula_weight	56989.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,M

KSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 6 Entity 6 polymer

Description description	T-complex protein 1 subunit zeta
Molecular weight formula_weight	56445.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,N

AEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAEALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 7 Entity 7 polymer

Description description	T-complex protein 1 subunit eta
Molecular weight formula_weight	56369.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,O

GTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALLNVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 8 Entity 8 polymer

Description description	T-complex protein 1 subunit theta
Molecular weight formula_weight	56102.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,P

MLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 9 Entity 9 polymer

Description description	Prefoldin subunit 1
Molecular weight formula_weight	12522.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

AFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 10 Entity 10 polymer

Description description	Prefoldin subunit 2
Molecular weight formula_weight	11862.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNI

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 11 Entity 11 polymer

Description description	Prefoldin subunit 3
Molecular weight formula_weight	15558.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

VLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKMCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVY

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 12 Entity 12 polymer

Description description	Prefoldin subunit 4
Molecular weight formula_weight	12142.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

DQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 13 Entity 13 polymer

Description description	Prefoldin subunit 5
Molecular weight formula_weight	14579.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

NLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

Entity 14 Entity 14 polymer

Description description	Prefoldin subunit 6
Molecular weight formula_weight	11775.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

VEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Insect cell expression vector pTIE1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	8.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	9478

hTRiC-hPFD Class5

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit zeta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit eta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit theta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Prefoldin subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Prefoldin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer