SAXSdb — 6q14

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipoprotein PrgK

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 74	Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgH × 24 （P41783） Protein InvG × 16 （P35672）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGK_SALTY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–252； UniProt 1–252 Author chain AB； PDBConstruct 1–252； UniProt 1–252 Author chain AC； PDBConstruct 1–252； UniProt 1–252 Author chain AD； PDBConstruct 1–252； UniProt 1–252 Author chain AE； PDBConstruct 1–252； UniProt 1–252 Author chain AF； PDBConstruct 1–252； UniProt 1–252 Author chain AG； PDBConstruct 1–252； UniProt 1–252 Author chain AH； PDBConstruct 1–252； UniProt 1–252 Author chain AI； PDBConstruct 1–252； UniProt 1–252 Author chain AJ； PDBConstruct 1–252； UniProt 1–252 Author chain AK； PDBConstruct 1–252； UniProt 1–252 Author chain AL； PDBConstruct 1–252； UniProt 1–252 Author chain o； PDBConstruct 1–252； UniProt 1–252 Author chain p； PDBConstruct 1–252； UniProt 1–252 Author chain q； PDBConstruct 1–252； UniProt 1–252 Author chain r； PDBConstruct 1–252； UniProt 1–252 Author chain s； PDBConstruct 1–252； UniProt 1–252 Author chain t； PDBConstruct 1–252； UniProt 1–252 Author chain u； PDBConstruct 1–252； UniProt 1–252 Author chain v； PDBConstruct 1–252； UniProt 1–252 Author chain w； PDBConstruct 1–252； UniProt 1–252 Author chain x； PDBConstruct 1–252； UniProt 1–252 Author chain y； PDBConstruct 1–252； UniProt 1–252 Author chain z； PDBConstruct 1–252； UniProt 1–252

Surface presentation of antigens protein SpaP

OrganismNot specified

UniProt P40700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 74	Lipoprotein PrgK × 24 （P41786） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgH × 24 （P41783） Protein InvG × 16 （P35672）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAP_SALTY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 0； PDBConstruct 1–224； UniProt 1–224 Author chain 1； PDBConstruct 1–224； UniProt 1–224 Author chain 2； PDBConstruct 1–224； UniProt 1–224 Author chain 3； PDBConstruct 1–224； UniProt 1–224 Author chain 4； PDBConstruct 1–224； UniProt 1–224

Surface presentation of antigens protein SpaR

OrganismNot specified

UniProt P40701

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 74	Lipoprotein PrgK × 24 （P41786） Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgH × 24 （P41783） Protein InvG × 16 （P35672）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAR_SALTY
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 5； PDBConstruct 1–263； UniProt 1–263

Surface presentation of antigens protein SpaQ

OrganismNot specified

UniProt P0A1L7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 74	Lipoprotein PrgK × 24 （P41786） Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Protein PrgH × 24 （P41783） Protein InvG × 16 （P35672）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAQ_SALTY
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 6； PDBConstruct 1–86； UniProt 1–86 Author chain 7； PDBConstruct 1–86； UniProt 1–86 Author chain 8； PDBConstruct 1–86； UniProt 1–86 Author chain 9； PDBConstruct 1–86； UniProt 1–86

Protein PrgH

OrganismNot specified

UniProt P41783

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 74	Lipoprotein PrgK × 24 （P41786） Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein InvG × 16 （P35672）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRGH_SALTY
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–392； UniProt 1–392 Author chain R； PDBConstruct 1–392； UniProt 1–392 Author chain S； PDBConstruct 1–392； UniProt 1–392 Author chain T； PDBConstruct 1–392； UniProt 1–392 Author chain U； PDBConstruct 1–392； UniProt 1–392 Author chain V； PDBConstruct 1–392； UniProt 1–392 Author chain W； PDBConstruct 1–392； UniProt 1–392 Author chain X； PDBConstruct 1–392； UniProt 1–392 Author chain Y； PDBConstruct 1–392； UniProt 1–392 Author chain Z； PDBConstruct 1–392； UniProt 1–392 Author chain a； PDBConstruct 1–392； UniProt 1–392 Author chain b； PDBConstruct 1–392； UniProt 1–392 Author chain c； PDBConstruct 1–392； UniProt 1–392 Author chain d； PDBConstruct 1–392； UniProt 1–392 Author chain e； PDBConstruct 1–392； UniProt 1–392 Author chain f； PDBConstruct 1–392； UniProt 1–392 Author chain g； PDBConstruct 1–392； UniProt 1–392 Author chain h； PDBConstruct 1–392； UniProt 1–392 Author chain i； PDBConstruct 1–392； UniProt 1–392 Author chain j； PDBConstruct 1–392； UniProt 1–392 Author chain k； PDBConstruct 1–392； UniProt 1–392 Author chain l； PDBConstruct 1–392； UniProt 1–392 Author chain m； PDBConstruct 1–392； UniProt 1–392 Author chain n； PDBConstruct 1–392； UniProt 1–392

Protein InvG

OrganismNot specified

UniProt P35672

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 74	Lipoprotein PrgK × 24 （P41786） Surface presentation of antigens protein SpaP × 5 （P40700） Surface presentation of antigens protein SpaR × 1 （P40701） Surface presentation of antigens protein SpaQ × 4 （P0A1L7） Protein PrgH × 24 （P41783）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INVG_SALTY
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–562； UniProt 1–562 Author chain B； PDBConstruct 1–562； UniProt 1–562 Author chain C； PDBConstruct 1–562； UniProt 1–562 Author chain D； PDBConstruct 1–562； UniProt 1–562 Author chain F； PDBConstruct 1–562； UniProt 1–562 Author chain G； PDBConstruct 1–562； UniProt 1–562 Author chain H； PDBConstruct 1–562； UniProt 1–562 Author chain I； PDBConstruct 1–562； UniProt 1–562 Author chain J； PDBConstruct 1–562； UniProt 1–562 Author chain K； PDBConstruct 1–562； UniProt 1–562 Author chain L； PDBConstruct 1–562； UniProt 1–562 Author chain M； PDBConstruct 1–562； UniProt 1–562 Author chain N； PDBConstruct 1–562； UniProt 1–562 Author chain O； PDBConstruct 1–562； UniProt 1–562 Author chain P； PDBConstruct 1–562； UniProt 1–562 Author chain Q； PDBConstruct 1–562； UniProt 1–562

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6q14
Deposition date deposition_date	2019-08-02
Structure title title	Structure of the Salmonella SPI-1 injectisome NC-base
Keywords keywords	Bacterial secretion, type III secretion, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6q14__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6q14__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6q14__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	99.45 Å
Total Rg	99.52 Å
Atom count	147819
Residues	18678
Excluded volume	2638400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6q14__assembly_1__model_1`	74-meric （74）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Lipoprotein PrgK
Molecular weight formula_weight	28245.3 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AL,o,p,q,r,s,t,u,v,w,x,y,z,AJ,AK
Atom count atom_count	147873

MIRRYLYTFLLVMTLAGCKDKDLLKGLDQEQANEVIAVLQMHNIEANKIDSGKLGYSITVAEPDFTAAVYWIKTYQLPPRPRVEIAQMFPADSLVSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYDIDAGENGRPPKPVHLSALAVYERGSPLAHQISDIKRFLKNSFADVDYDNISVVLSERSDAQLQAPGTPVKRNSFATSWIVLIILLSVMSAGFGVWYYKNHYARNKKGITADDKAKSSNE

Entity 2 Entity 2 polymer

Description description	Surface presentation of antigens protein SpaP
Molecular weight formula_weight	25249.6 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,2,3,4

MGNDISLIALLAFSTLLPFIIASGTCFVKFSIVFVMVRNALGLQQIPSNMTLNGVALLLSMFVMWPIMHDAYVYFEDEDVTFNDISSLSKHVDEGLDGYRDYLIKYSDRELVQFFENAQLKRQYGEETETVKRDKDEIEKPSIFALLPAYALSEIKSAFKIGFYLYLPFVVVDLVVSSVLLALGMMMMSPVTISTPIKLVLFVALDGWTLLSKGLILQYMDIAT

Entity 3 Entity 3 polymer

Description description	Surface presentation of antigens protein SpaR
Molecular weight formula_weight	28499.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MFYALYFEIHHLVASAALGFARVAPIFFFLPFLNSGVLSGAPRNAIIILVALGVWPHALNEAPPFLSVAMIPLVLQEAAVGVMLGCLLSWPFWVMHALGCIIDNQRGATLSSSIDPANGIDTSEMANFLNMFAAVVYLQNGGLVTMVDVLNKSYQLCDPMNECTPSLPPLLTFINQVAQNALVLASPVVLVLLLSEVFLGLLSRFAPQMNAFAISLTVKSGIAVLIMLLYFSPVLPDNVLRLSFQATGLSSWFYERGATHVLE

Entity 4 Entity 4 polymer

Description description	Surface presentation of antigens protein SpaQ
Molecular weight formula_weight	9363.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6,7,8,9

MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIFLALAKG

Entity 5 Entity 5 polymer

Description description	Protein PrgH
Molecular weight formula_weight	44509.4 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h,i,j,k,l,m,n

METSKEKTITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSFFIPLDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPWVPEQPEKLETSAKKNEPRFKNGIVAALAGFFILGIGTVGTLWILNSPQRQAAELDSLLGQEKERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYYPQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGRSFQYGAEGYIKMSPGHWYFPSPL

Entity 6 Entity 6 polymer

Description description	Protein InvG
Molecular weight formula_weight	61835.6 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,A,B,C,D,F,G,H,I,J,K,L,M,N,O,P

MKTHILLARVLACAALVLVTPGYSSEKIPVTGSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQNDGIELGRQKIGVMRLNNTFVGDRTYNLRDQKMVIPGIATAIERLLQGEEQPLGNIVSSEPPAMPAFSANGEKGKAANYAGGMSLQEALKQNAAAGNIKIVAYPDTNSLLVKGTAEQVHFIEMLVKALDVAKRHVELSLWIVDLNKSDLERLGTSWSGSITIGDKLGVSLNQSSISTLDGSRFIAAVNALEEKKQATVVSRPVLLTQENVPAIFDNNRTFYTKLIGERNVALEHVTYGTMIRVLPRFSADGQIEMSLDIEDGNDKTPQSDTTTSVDALPEVGRTLISTIARVPHGKSLLVGGYTRDANTDTVQSIPFLGKLPLIGSLFRYSSKNKSNVVRVFMIEPKEIVDPLTPDASESVNNILKQSGAWSGDDKLQKWVRVYLDRGQEAIK

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	51816

Structure of the Salmonella SPI-1 injectisome NC-base

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lipoprotein PrgK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Surface presentation of antigens protein SpaQ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein PrgH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein InvG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6q14__assembly_1__model_1

6q14__assembly_1__model_1 | I(q)

6q14__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)