SAXSdb — 6qpw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Structural maintenance of chromosomes protein,Structural maintenance of chromosomes protein

Chaetomium thermophilum var. thermophilum DSM 1495

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Sister chromatid cohesion protein 1 × 1 （Q12158） Structural maintenance of chromosomes protein 3,Structural maintenance of chromosomes protein 3 × 1 （P47037） MAGNESIUM ION × 2 PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SGH3_CHATD
Isoform	—
PDB entities	1, 4
Chains and sequence ranges	Author chain A； PDBConstruct 1–159； UniProt 1–159 Author chain A； PDBConstruct 160–242； UniProt 160–242 Author chain E； PDBConstruct 160–366； UniProt 1058–1264

Sister chromatid cohesion protein 1

Saccharomyces cerevisiae S288C

UniProt Q12158

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Structural maintenance of chromosomes protein,Structural maintenance of chromosomes protein × 1 （G0SGH3） Structural maintenance of chromosomes protein 3,Structural maintenance of chromosomes protein 3 × 1 （P47037） MAGNESIUM ION × 2 PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCC1_YEAST
Isoform	—
PDB entities	2, 4
Chains and sequence ranges	Author chain B； PDBConstruct 2–85； UniProt 481–564 Author chain E； PDBConstruct 1–159； UniProt 1–159

Structural maintenance of chromosomes protein 3,Structural maintenance of chromosomes protein 3

Saccharomyces cerevisiae S288C

UniProt P47037

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Structural maintenance of chromosomes protein,Structural maintenance of chromosomes protein × 1 （G0SGH3） Sister chromatid cohesion protein 1 × 1 （Q12158） Sister chromatid cohesion protein 1,Structural maintenance of chromosomes protein × 1 （G0SGH3,Q12158） MAGNESIUM ION × 2 PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMC3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 3–262； UniProt 2–261 Author chain C； PDBConstruct 275–535； UniProt 970–1230

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qpw
Deposition date deposition_date	2019-02-15
Structure title title	Structural basis of cohesin ring opening
Keywords keywords	Chromatin, genome segregation, cohesin, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qpw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qpw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qpw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.38 Å
Rg (electron density)	32.60 Å
Total Rg	33.09 Å
Atom count	6784
Residues	839
Excluded volume	120540 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qpw__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Structural maintenance of chromosomes protein,Structural maintenance of chromosomes protein
Molecular weight formula_weight	27570.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	6784

MGKLIRLELFNFKSYKGHHTLLFGDSYFTSIIGPNGSGKSNSMDAISFVLGIKSSHLRSSNLRDLIYRGRVMKTSKIQDDGTTAPATNGDVNGYENGDAGDDEDTSQRTSRNDPKTAWVMAVYEDDAGELHRWKRTITANGTSEYRINDRVVNAQQYNEALEKENILIKARNFLVFQGDVEAIASQSPQDLTRLIEQISGSLEYKEEYERLEEEVRQATEEQAYKLQRRRAANSEIKQYMEQ

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Sister chromatid cohesion protein 1
Molecular weight formula_weight	9489.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPENITKREASRGFFDILSLATEGCIGLSQTEAFGNIKIDAKPALFERFI

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Structural maintenance of chromosomes protein 3,Structural maintenance of chromosomes protein 3
Molecular weight formula_weight	61051.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELNEVINQMERLDGDYNNTVYSSESSKHPTSLVPRGSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDACLDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYECKISTVIEVNREEAIGFIRGSNKFAEV

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Sister chromatid cohesion protein 1,Structural maintenance of chromosomes protein
Molecular weight formula_weight	42292.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEIAKASGSDDESGDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLFKTSQKMTSTVNRLNTVTRVHQLMLEDAVTEREVLVTPGLEFLDDTTIPVGLMAQENPNLRAMDRLDHVRKQLEQTEQEFEASKAKLRQARESFQAVKQKRLELFNKAFTHIQEQITHVYKELTRSEAYPLGGQAYLDIEEDTDTPFLSGVKYHAMPPCKRFRDMEHLSGGEKTMAALALLFAIHSYQPSPFFVLDEVDCALDNANVEKIKKYIREHAGPGMQFIVISLKPALFQASESLIGVYRDQEANTSRTLTLDLRKYRHHHHHH

Source Source

Source organism organism	Chaetomium thermophilum var. thermophilum DSM 1495
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	6qpwA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6qpwB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	580 — Structural maintenance of chromosome 1. Chain E

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	178162

Structural basis of cohesin ring opening

1. Protein Identity and Related Structures Protein Identity & Related Structures

Structural maintenance of chromosomes protein,Structural maintenance of chromosomes protein

State in the Current Structure

Other States of the Same Protein in the Database

Sister chromatid cohesion protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Structural maintenance of chromosomes protein 3,Structural maintenance of chromosomes protein 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qpw__assembly_1__model_1

6qpw__assembly_1__model_1 | I(q)

6qpw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Structural basis of cohesin ring opening

1. Protein Identity and Related Structures Protein Identity & Related Structures

Structural maintenance of chromosomes protein,Structural maintenance of chromosomes protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sister chromatid cohesion protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Structural maintenance of chromosomes protein 3,Structural maintenance of chromosomes protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qpw__assembly_1__model_1

6qpw__assembly_1__model_1 | I(q)

6qpw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)