SAXSdb — 6s6t

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glutamate synthase [NADPH] large chain

Azospirillum brasilense

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Glutamate synthase [NADPH] small chain × 3 （Q05756） FLAVIN MONONUCLEOTIDE × 4 FE3-S4 CLUSTER × 4 IRON/SULFUR CLUSTER × 6 FLAVIN-ADENINE DINUCLEOTIDE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLTB_AZOBR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1515； UniProt 1–1515 Author chain B； PDBConstruct 1–1515； UniProt 1–1515 Author chain C； PDBConstruct 1–1515； UniProt 1–1515 Author chain D； PDBConstruct 1–1515； UniProt 1–1515

Glutamate synthase [NADPH] small chain

Azospirillum brasilense

UniProt Q05756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Glutamate synthase [NADPH] large chain × 4 （Q05755） FLAVIN MONONUCLEOTIDE × 4 FE3-S4 CLUSTER × 4 IRON/SULFUR CLUSTER × 6 FLAVIN-ADENINE DINUCLEOTIDE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLTD_AZOBR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–482； UniProt 1–482 Author chain F； PDBConstruct 1–482； UniProt 1–482 Author chain G； PDBConstruct 1–482； UniProt 1–482

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6s6t
Deposition date deposition_date	2019-07-03
Structure title title	Structure of Azospirillum brasilense Glutamate Synthase in a4b3 oligomeric state
Keywords keywords	glutamate synthesys, complex, oligomeric assemblies, FLAVOPROTEIN; FLAVOPROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6s6t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6s6t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6s6t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	69.95 Å
Rg (electron density)	69.42 Å
Total Rg	69.53 Å
Atom count	56540
Residues	7301
Excluded volume	1002600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6s6t__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Glutamate synthase [NADPH] large chain
Molecular weight formula_weight	166224.7 kDa
EC 编号 ec_number	1.4.1.13
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	56543

MTTELNQGEQFVADFRANAAALTTANAYNPEDEHDACGVGFIAAIDGKPRRSVVEKGIEALKAVWHRGAVDADGKTGDGAGIHVAVPQKFFKDHVKVIGHRAPDNKLAVGQVFLPRISLDAQEACRCIVETEILAFGYYIYGWRQVPINVDIIGEKANATRPEIEQIIVGNNKGVSDEQFELDLYIIRRRIEKAVKGEQINDFYICSLSARSIIYKGMFLAEQLTTFYPDLLDERFESDFAIYHQRYSTNTFPTWPLAQPFRMLAHNGEINTVKGNVNWMKAHETRMEHPAFGTHMQDLKPVIGVGLSDSGSLDTVFEVMVRAGRTAPMVKMMLVPQALTSSQTTPDNHKALIQYCNSVMEPWDGPAALAMTDGRWVVGGMDRNGLRPMRYTITTDGLIIGGSETGMVKIDETQVIEKGRLGPGEMIAVDLQSGKLYRDRELKDHLATLKPWDKWVQNTTHLDELVKTASLKGEPSDMDKAELRRRQQAFGLTMEDMELILHPMVEDGKEAIGSMGDDSPIAVLSDKYRGLHHFFRQNFSQVTNPPIDSLRERRVMSLKTRLGNLGNILDEDETQTRLLQLESPVLTTAEFRAMRDYMGDTAAEIDATFPVDGGPEALRDALRRIRQETEDAVRGGATHVILTDEAMGPARAAIPAILATGAVHTHLIRSNLRTFTSLNVRTAEGLDTHYFAVLIGVGATTVNAYLAQEAIAERHRRGLFGSMPLEKGMANYKKAIDDGLLKIMSKMGISVISSYRGGGNFEAIGLSRALVAEHFPAMVSRISGIGLNGIQKKVLEQHATAYNEEVVALPVGGFYRFRKSGDRHGWEGGVIHTLQQAVTNDSYTTFKKYSEQVNKRPPMQLRDLLELRSTKAPVPVDEVESITAIRKRFITPGMSMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRPDKNGDNWNSAIKQVASGRFGVTAEYLNQCRELEIKVAQGAKPGEGGQLPGFKVTEMIARLRHSTPGVMLISPPPHHDIYSIEDLAQLIYDLKQINPDAKVTVKLVSRSGIGTIAAGVAKANADIILISGNSGGTGASPQTSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDGGLKTGRDIVIAAMLGAEEFGIGTASLIAMGCIMVRQCHSNTCPVGVCVQDDKLRQKFVGTPEKVVNLFTFLAEEVREILAGLGFRSLNEVIGRTDLLHQVSRGAEHLDDLDLNPRLAQVDPGENARYCTLQGRNEVPDTLDARIVADARPLFEEGEKMQLAYNARNTQRAIGTRLSSMVTRKFGMFGLQPGHITIRLRGTAGQSLGAFAVQGIKLEVMGDANDYVGKGLSGGTIVVRPTTSSPLETNKNTIIGNTVLYGATAGKLFAAGQAGERFAVRNSGATVVVEGCGSNGCEYMTGGTAVILGRVGDNFAAGMTGGMAYVYDLDDSLPLYINDESVIFQRIEVGHYESQLKHLIEEHVTETQSRFAAEILNDWAREVTKFWQVVPKEMLNRLEVPVHLPKAISAE

Source Source

Source organism organism	Azospirillum brasilense
NCBI taxonomy ID ncbi_taxonomy_id	192
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Glutamate synthase [NADPH] small chain
Molecular weight formula_weight	52425.1 kDa
EC 编号 ec_number	1.4.1.13
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G

MANQRMLGFVHTAQRMPDKRPAAERRQDFAEIYARFSDERANEQANRCSQCGVPFCQVHCPVSNNIPDWLKLTSEGRLEEAYEVSQATNNFPEICGRICPQDRLCEGNCVIEQSTHGAVTIGSVEKYINDTAWDQGWVKPRTPSRELGLSVGVIGAGPAGLAAAEELRAKGYEVHVYDRYDRMGGLLVYGIPGFKLEKSVVERRVKLLADAGVIYHPNFEVGRDASLPELRRKHVAVLVATGVYKARDIKAPGSGLGNIVAALDYLTTSNKVSLGDTVEAYENGSLNAAGKHVVVLGGGDTAMDCVRTAIRQGATSVKCLYRRDRKNMPGSQREVAHAEEEGVEFIWQAAPEGFTGDTVVTGVRAVRIHLGVADATGRQTPQVIEGSEFTVQADLVIKALGFEPEDLPNAFDEPELKVTRWGTLLVDHRTKMTNMDGVFAAGDIVRGASLVVWAIRDGRDAAEGIHAYAKAKAEAPVAVAAE

Source Source

Source organism organism	Azospirillum brasilense
NCBI taxonomy ID ncbi_taxonomy_id	192
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	FE3-S4 CLUSTER
Molecular weight formula_weight	295.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.100 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	47735

Structure of Azospirillum brasilense Glutamate Synthase in a4b3 oligomeric state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glutamate synthase [NADPH] large chain

State in the Current Structure

Other States of the Same Protein in the Database

Glutamate synthase [NADPH] small chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6s6t__assembly_1__model_1

6s6t__assembly_1__model_1 | I(q)

6s6t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Structure of Azospirillum brasilense Glutamate Synthase in a4b3 oligomeric state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glutamate synthase [NADPH] large chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glutamate synthase [NADPH] small chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6s6t__assembly_1__model_1

6s6t__assembly_1__model_1 | I(q)

6s6t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)