SAXSdb — 6tvw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope glycoprotein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	Transmembrane protein gp41,Envelope glycoprotein gp160 × 3 （A0A650FAD5,P04582） water × 6	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5VGF0_9HIV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain CCC； PDBConstruct 1–38； UniProt 1–38

Transmembrane protein gp41,Envelope glycoprotein gp160

OrganismNot specified

UniProt A0A650FAD5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	Envelope glycoprotein × 3 （Q5VGF0） water × 6	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A650FAD5_9HIV1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain DbD； PDBConstruct 16–31； UniProt 626–641

Transmembrane protein gp41,Envelope glycoprotein gp160

OrganismNot specified

UniProt P04582

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	Envelope glycoprotein × 3 （Q5VGF0） water × 6	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENV_HV1B8
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain DbD； PDBConstruct 2–15； UniProt 631–644

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6tvw
Deposition date deposition_date	2020-01-10
Structure title title	Structure of native gp41 derived peptide fusion inhibitor
Keywords keywords	Inhibitor, helix bundle, HIV, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6tvw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6tvw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6tvw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.90 Å
Rg (electron density)	17.81 Å
Total Rg	18.76 Å
Atom count	3141
Residues	180
Excluded volume	27946 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6tvw__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Envelope glycoprotein
Molecular weight formula_weight	4491.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CCC
Atom count atom_count	1171

NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ

Entity 2 Entity 2 polymer

Description description	Transmembrane protein gp41,Envelope glycoprotein gp160
Molecular weight formula_weight	3967.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DbD

XNNYTSLIHSLIEESQEQIWNNMTWMEWDRE

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	74

▶

Unit-cell length a length_a	44.706 Å
Unit-cell length b length_b	44.706 Å
Unit-cell length c length_c	208.857 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	1.450 Å
Low-resolution limit resolution_low	69.619 Å
R factor r_factor	—
R_work r_work	0.2338
R_free r_free	0.2983

Structure of native gp41 derived peptide fusion inhibitor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Transmembrane protein gp41,Envelope glycoprotein gp160

State in the Current Structure

Other States of the Same Protein in the Database

Transmembrane protein gp41,Envelope glycoprotein gp160

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6tvw__assembly_1__model_1

6tvw__assembly_1__model_1 | I(q)

6tvw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Structure of native gp41 derived peptide fusion inhibitor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transmembrane protein gp41,Envelope glycoprotein gp160

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transmembrane protein gp41,Envelope glycoprotein gp160

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6tvw__assembly_1__model_1

6tvw__assembly_1__model_1 | I(q)

6tvw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)