SAXSdb — 6w6o

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NaChBac-Nav1.7VSDII chimera

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	Huwentoxin-IV × 4 （P83303） (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCN9A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 98–113； UniProt 817–832 Author chain D； PDBConstruct 98–113； UniProt 817–832 Author chain F； PDBConstruct 98–113； UniProt 817–832 Author chain H； PDBConstruct 98–113； UniProt 817–832

NaChBac-Nav1.7VSDII chimera

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

UniProt Q9KCR8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	Huwentoxin-IV × 4 （P83303） (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9KCR8_BACHD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–97； UniProt 1–97 Author chain A； PDBConstruct 114–277； UniProt 111–274 Author chain D； PDBConstruct 1–97； UniProt 1–97 Author chain D； PDBConstruct 114–277； UniProt 111–274 Author chain F； PDBConstruct 1–97； UniProt 1–97 Author chain F； PDBConstruct 114–277； UniProt 111–274 Author chain H； PDBConstruct 1–97； UniProt 1–97 Author chain H； PDBConstruct 114–277； UniProt 111–274

Huwentoxin-IV

OrganismNot specified

UniProt P83303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	NaChBac-Nav1.7VSDII chimera × 4 （Q15858,Q9KCR8） (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXH4_CYRSC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–35； UniProt 53–87 Author chain E； PDBConstruct 1–35； UniProt 53–87 Author chain G； PDBConstruct 1–35； UniProt 53–87 Author chain I； PDBConstruct 1–35； UniProt 53–87

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6w6o
Deposition date deposition_date	2020-03-17
Structure title title	NaChBac-Nav1.7VSDII chimera and HWTX-IV complex
Keywords keywords	NaChBac, Channels, Sodium Ion-Selective, TRANSPORT PROTEIN-TOXIN complex; TRANSPORT PROTEIN/TOXIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6w6o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6w6o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6w6o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.34 Å
Rg (electron density)	37.30 Å
Total Rg	38.04 Å
Atom count	9180
Residues	1044
Excluded volume	171880 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6w6o__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	NaChBac-Nav1.7VSDII chimera
Molecular weight formula_weight	31901.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,F,H
Atom count atom_count	9180

MKMEARQKQNSFTSKMQKIVNHRAFTFTVIALILFNALIVGIETYPRIYADHKWLFYRIDLVLLWIFTIEIAMRFLASNPKSAFFRSSWNWFDFLIVTLSLVELFLADVEGLSVLRILRVLRVLRAISVVPSLRRLVDALVMTIPALGNILILMSIFFYIFAVIGTMLFQHVSPEYFGNLQLSLLTLFQVVTLESWASGVMRPIFAEVPWSWLYFVSFVLIGTFIIFNLFIGVIVNNVEKAELTDNEEDGEADGLKQEISALRKDVAELKSLLKQSK

Source Source

Source organism organism	Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
NCBI taxonomy ID ncbi_taxonomy_id	272558
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Huwentoxin-IV
Molecular weight formula_weight	4120.9 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E,G,I

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI

Entity 3 Entity 3 non-polymer

Description description	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
Molecular weight formula_weight	760.1 kDa
Source method src_method	syn
Copy count entity_count	12

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	6w6oA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	350 — Voltage-gated potassium channels. Chain C

Domain ID domain_id	6w6oA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6w6oD01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	350 — Voltage-gated potassium channels. Chain C

Domain ID domain_id	6w6oD02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6w6oF01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	350 — Voltage-gated potassium channels. Chain C

Domain ID domain_id	6w6oF02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6w6oH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	350 — Voltage-gated potassium channels. Chain C

Domain ID domain_id	6w6oH02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

▶

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	49149

NaChBac-Nav1.7VSDII chimera and HWTX-IV complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

NaChBac-Nav1.7VSDII chimera

State in the Current Structure

Other States of the Same Protein in the Database

NaChBac-Nav1.7VSDII chimera

State in the Current Structure

Other States of the Same Protein in the Database

Huwentoxin-IV

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6w6o__assembly_1__model_1

6w6o__assembly_1__model_1 | I(q)

6w6o__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

NaChBac-Nav1.7VSDII chimera and HWTX-IV complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

NaChBac-Nav1.7VSDII chimera

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NaChBac-Nav1.7VSDII chimera

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Huwentoxin-IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6w6o__assembly_1__model_1

6w6o__assembly_1__model_1 | I(q)

6w6o__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)