SAXSdb — 6wc2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

Homo sapiens

UniProt Q02078

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain A； UniProt 1–72 Chain A； UniProt 92–95 Chain B； UniProt 1–72 Chain B； UniProt 92–95	Not recorded	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225
2	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain C； UniProt 1–72 Chain C； UniProt 92–95 Chain D； UniProt 1–72 Chain D； UniProt 92–95	Not recorded	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225
3	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain I； UniProt 1–72 Chain I； UniProt 92–95 Chain J； UniProt 1–72 Chain J； UniProt 92–95	Not recorded	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6WC2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1C7U Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer oligonucleotide Deposited 2000-03-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 2–86（85 aa） Fragment：RESIDUES 2-86 Chain B 2–86（85 aa） Fragment：RESIDUES 2-86	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.6；308 K	Resolution not provided
1EGW CRYSTAL STRUCTURE OF MEF2A CORE BOUND TO DNA Deposited 2000-02-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 2–78（77 aa） Fragment：N-TERMINUS, RESIDUES 2-78 Chain B 2–78（77 aa） Fragment：N-TERMINUS, RESIDUES 2-78	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；PEG 6000, NaCl, Ba(NO3)2, sodium Acetate, Bis-tris buffer, DTT, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.50 Å R-free 0.229
1EGW CRYSTAL STRUCTURE OF MEF2A CORE BOUND TO DNA Deposited 2000-02-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 2–78（77 aa） Fragment：N-TERMINUS, RESIDUES 2-78 Chain D 2–78（77 aa） Fragment：N-TERMINUS, RESIDUES 2-78	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；PEG 6000, NaCl, Ba(NO3)2, sodium Acetate, Bis-tris buffer, DTT, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.50 Å R-free 0.229
1LEW CRYSTAL STRUCTURE OF MAP KINASE P38 COMPLEXED TO THE DOCKING SITE ON ITS NUCLEAR SUBSTRATE MEF2A Deposited 2002-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 269–280（12 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；289 K；PEG 8000, HEPES, pH 7.5, VAPOR DIFFUSION, temperature 289K	Resolution 2.30 Å R-free 0.257
3KOV Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that recognizes DNA and recruits transcription co-factors Deposited 2009-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 2–91（90 aa） Chain B 2–91（90 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 4.7；291 K；50 mM acetic acid, 142mM NaCl, 5mM MgCl2, 10mM CaCl2, 3.3% Glycerol, 22.5% 3K PEG, pH 4.7, hanging drop, temperature 291K	Resolution 2.90 Å R-free 0.279
3KOV Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that recognizes DNA and recruits transcription co-factors Deposited 2009-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain I 2–91（90 aa） Chain J 2–91（90 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 4.7；291 K；50 mM acetic acid, 142mM NaCl, 5mM MgCl2, 10mM CaCl2, 3.3% Glycerol, 22.5% 3K PEG, pH 4.7, hanging drop, temperature 291K	Resolution 2.90 Å R-free 0.279
3MU6 Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by Small Molecules Deposited 2010-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 2–72（71 aa） Chain B 2–72（71 aa）	Mutation：E71A Mutation：E71A	BXL (3E)-N~8~-(2-aminophenyl)-N~1~-phenyloct-3-enediamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 4.7；291 K；50 mM acetic acid, 142mM NaCl, 5mM MgCl2, 10mM CaCl2, 3.3% Glycerol, 22.5% 3K PEG, pH 4.7, hanging drop, temperature 291K	Resolution 2.43 Å R-free 0.251
3MU6 Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by Small Molecules Deposited 2010-05-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 2–72（71 aa） Chain D 2–72（71 aa）	Mutation：E71A Mutation：E71A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 4.7；291 K；50 mM acetic acid, 142mM NaCl, 5mM MgCl2, 10mM CaCl2, 3.3% Glycerol, 22.5% 3K PEG, pH 4.7, hanging drop, temperature 291K	Resolution 2.43 Å R-free 0.251
3P57 Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA Deposited 2010-10-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 7 PDB declaration: tridecameric	Chain A 2–91（90 aa） Fragment：N terminal domain (UNP residues 2-91) Chain B 2–91（90 aa） Fragment：N terminal domain (UNP residues 2-91) Chain C 2–91（90 aa） Fragment：N terminal domain (UNP residues 2-91) Chain D 2–91（90 aa） Fragment：N terminal domain (UNP residues 2-91) Chain I 2–91（90 aa） Fragment：N terminal domain (UNP residues 2-91) Chain J 2–91（90 aa） Fragment：N terminal domain (UNP residues 2-91)	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；288 K；16% PEG 1000, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 288K	Resolution 2.19 Å R-free 0.272
6BYY MEF2 CHIMERA/DNA Complex Deposited 2017-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 1–64（64 aa） Chain A 92–95（4 aa） Chain B 1–64（64 aa） Chain B 92–95（4 aa）	Not recorded	1PG 2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.1 M HAc pH 4.7, 150 mM NaCl, 10 mM CaCl2, 5 mM MgCl2 and 28% PEG 400	Resolution 2.30 Å R-free 0.266
6BYY MEF2 CHIMERA/DNA Complex Deposited 2017-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 1–64（64 aa） Chain C 92–95（4 aa） Chain D 1–64（64 aa） Chain D 92–95（4 aa）	Not recorded	TCE 3,3',3''-phosphanetriyltripropanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.1 M HAc pH 4.7, 150 mM NaCl, 10 mM CaCl2, 5 mM MgCl2 and 28% PEG 400	Resolution 2.30 Å R-free 0.266
6BZ1 MEF2 Chimera D83V mutant/DNA complex Deposited 2017-12-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 1–64（64 aa） Chain C 92–95（4 aa） Chain D 1–64（64 aa） Chain D 92–95（4 aa）	Mutation：D83V Mutation：D83V Mutation：D83V Mutation：D83V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.1M MES pH 5.94, 0.2 M NaCl and 18% PEG2000MME	Resolution 2.97 Å R-free 0.190
6BZ1 MEF2 Chimera D83V mutant/DNA complex Deposited 2017-12-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 1–64（64 aa） Chain A 92–95（4 aa） Chain B 1–64（64 aa） Chain B 92–95（4 aa）	Mutation：D83V Mutation：D83V Mutation：D83V Mutation：D83V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.1M MES pH 5.94, 0.2 M NaCl and 18% PEG2000MME	Resolution 2.97 Å R-free 0.190

8 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MEF2A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–72； UniProt 1–72 Author chain A； PDBConstruct 92–95； UniProt 92–95 Author chain B； PDBConstruct 1–72； UniProt 1–72 Author chain B； PDBConstruct 92–95； UniProt 92–95 Author chain C； PDBConstruct 1–72； UniProt 1–72 Author chain C； PDBConstruct 92–95； UniProt 92–95 Author chain D； PDBConstruct 1–72； UniProt 1–72 Author chain D； PDBConstruct 92–95； UniProt 92–95 Author chain I； PDBConstruct 1–72； UniProt 1–72 Author chain I； PDBConstruct 92–95； UniProt 92–95 Author chain J； PDBConstruct 1–72； UniProt 1–72 Author chain J； PDBConstruct 92–95； UniProt 92–95

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

Homo sapiens

UniProt Q02080

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain A； UniProt 73–91 Chain B； UniProt 73–91	Not recorded	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225
2	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain C； UniProt 73–91 Chain D； UniProt 73–91	Not recorded	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225
3	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain I； UniProt 73–91 Chain J； UniProt 73–91	Not recorded	Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1 Homeobox protein Nkx-2.5 × 1 （P52952）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6WC2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1N6J Structural basis of sequence-specific recruitment of histone deacetylases by Myocyte Enhancer Factor-2 Deposited 2002-11-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 2–94（93 aa） Fragment：residues 2-91, MADS-box/MEF2S domain Chain B 2–94（93 aa） Fragment：residues 2-91, MADS-box/MEF2S domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；298 K；PEG 3500, sodium cholride, BTP, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.268
1TQE Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2 Deposited 2004-06-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain P 1–93（93 aa） Fragment：residues 1-93 Chain Q 1–93（93 aa） Fragment：residues 1-93	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.35；315 K；BTP, PEG, NaCl, glycerol, MgCl2, CaCl2, pH 6.35, VAPOR DIFFUSION, HANGING DROP, temperature 315K	Resolution 2.70 Å R-free 0.289
1TQE Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2 Deposited 2004-06-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain R 1–93（93 aa） Fragment：residues 1-93 Chain S 1–93（93 aa） Fragment：residues 1-93	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.35；315 K；BTP, PEG, NaCl, glycerol, MgCl2, CaCl2, pH 6.35, VAPOR DIFFUSION, HANGING DROP, temperature 315K	Resolution 2.70 Å R-free 0.289
6BYY MEF2 CHIMERA/DNA Complex Deposited 2017-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 65–91（27 aa） Chain B 65–91（27 aa）	Not recorded	1PG 2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.1 M HAc pH 4.7, 150 mM NaCl, 10 mM CaCl2, 5 mM MgCl2 and 28% PEG 400	Resolution 2.30 Å R-free 0.266
6BYY MEF2 CHIMERA/DNA Complex Deposited 2017-12-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 65–91（27 aa） Chain D 65–91（27 aa）	Not recorded	TCE 3,3',3''-phosphanetriyltripropanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.1 M HAc pH 4.7, 150 mM NaCl, 10 mM CaCl2, 5 mM MgCl2 and 28% PEG 400	Resolution 2.30 Å R-free 0.266
6BZ1 MEF2 Chimera D83V mutant/DNA complex Deposited 2017-12-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain C 65–91（27 aa） Chain D 65–91（27 aa）	Mutation：D83V Mutation：D83V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.1M MES pH 5.94, 0.2 M NaCl and 18% PEG2000MME	Resolution 2.97 Å R-free 0.190
6BZ1 MEF2 Chimera D83V mutant/DNA complex Deposited 2017-12-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 65–91（27 aa） Chain B 65–91（27 aa）	Mutation：D83V Mutation：D83V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；292 K；0.1M MES pH 5.94, 0.2 M NaCl and 18% PEG2000MME	Resolution 2.97 Å R-free 0.190
6C9L MEF2B Apo Protein Structure Deposited 2018-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–93（93 aa） Chain B 1–93（93 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.4 M NaCl, 0.1 M Bis-Tris pH 5.5, 20% PEG3350	Resolution 2.30 Å R-free 0.235
6C9L MEF2B Apo Protein Structure Deposited 2018-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–93（93 aa） Chain D 1–93（93 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.4 M NaCl, 0.1 M Bis-Tris pH 5.5, 20% PEG3350	Resolution 2.30 Å R-free 0.235
6C9L MEF2B Apo Protein Structure Deposited 2018-01-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–93（93 aa） Chain F 1–93（93 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.4 M NaCl, 0.1 M Bis-Tris pH 5.5, 20% PEG3350	Resolution 2.30 Å R-free 0.235
6WC5 Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex Deposited 2020-03-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 2–91（90 aa） Chain B 2–91（90 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100 mM HEPES pH 7.0, 18% PEG 2000	Resolution 2.90 Å R-free 0.251
6WC5 Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex Deposited 2020-03-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain C 2–91（90 aa） Chain D 2–91（90 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100 mM HEPES pH 7.0, 18% PEG 2000	Resolution 2.90 Å R-free 0.251

6 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MEF2B_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 73–91； UniProt 73–91 Author chain B； PDBConstruct 73–91； UniProt 73–91 Author chain C； PDBConstruct 73–91； UniProt 73–91 Author chain D； PDBConstruct 73–91； UniProt 73–91 Author chain I； PDBConstruct 73–91； UniProt 73–91 Author chain J； PDBConstruct 73–91； UniProt 73–91

Homeobox protein Nkx-2.5

Homo sapiens

UniProt P52952

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain O； UniProt 137–197	Not recorded	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A × 2 （Q02078,Q02080） Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225
2	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain M； UniProt 137–197	Not recorded	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A × 2 （Q02078,Q02080） Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225
3	Insufficient information Heteromer Protein × 3 DNA 2 PDB declaration: pentameric（5） Consistent with all polymer counts	Chain N； UniProt 137–197	Not recorded	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A × 2 （Q02078,Q02080） Myocardin Enhancer DNA × 1 Myocardin Enhancer DNA × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；291 K；0.15 M DL-Malic acid pH 7.0, 20% Polyethylene glycol 3350	Resolution 2.10 Å R-free 0.225

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6WC2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3RKQ NKX2.5 Homeodomain dimer bound to ANF-242 DNA Deposited 2011-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 138–194（57 aa） Fragment：Homeodomain, UNP residues 138-194 Chain B 138–194（57 aa） Fragment：Homeodomain, UNP residues 138-194	Mutation：C193S Mutation：C193S	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；50mM Tris pH 7.0, 5mM MgCl2, 15% polyethylene glycol monomethyl ether 550 , VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.70 Å R-free 0.257
4S0H TBX5 DB, NKX2.5 HD, ANF DNA Complex Deposited 2014-12-31	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 142–194（53 aa） Fragment：HD (UNP residues 142-194)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.82 Å R-free 0.247
4S0H TBX5 DB, NKX2.5 HD, ANF DNA Complex Deposited 2014-12-31	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain F 142–194（53 aa） Fragment：HD (UNP residues 142-194)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.82 Å R-free 0.247
6WC5 Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex Deposited 2020-03-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain I 140–196（57 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100 mM HEPES pH 7.0, 18% PEG 2000	Resolution 2.90 Å R-free 0.251
6WC5 Crystal Structure of a Ternary MEF2B/NKX2-5/myocardin enhancer DNA Complex Deposited 2020-03-29	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain N 140–196（57 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；100 mM HEPES pH 7.0, 18% PEG 2000	Resolution 2.90 Å R-free 0.251

3 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NKX25_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain M； PDBConstruct 1–61； UniProt 137–197 Author chain N； PDBConstruct 1–61； UniProt 137–197 Author chain O； PDBConstruct 1–61； UniProt 137–197

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6wc2
Deposition date deposition_date	2020-03-29
Structure title title	Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
Keywords keywords	Transcription Factor, DNA binding Protein, Cardiogenesis, Carcinogenesis, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	40.18 Å
Radius of gyration Rg (electron density) rg_electron	40.07 Å
Forward intensity I(0) i0	327668000.00
Molecular weight molecular_weight	123120.0 kDa
Excluded volume excluded_volume	144040 Å³
Envelope volume envelope_volume	213600 Å³
Hydration-shell volume shell_volume	45815 Å³
Envelope diameter envelope_diameter	141.7 Å
Shell Rg shell_rg	44.27 Å
Envelope Rg envelope_rg	39.20 Å
Shape Rg shape_rg	40.07 Å
Total Rg total_rg	40.28 Å
Total atoms total_atoms	8494
Residues n_residues	830
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	137.8 Å
Rg (real space) rg_real	40.30 Å
Rg uncertainty (real space) rg_real_error	1.36 Å
I(0) (real space) i0_real	3.2770e+08
I(0) uncertainty (real space) i0_real_error	5.9730e+06
Rg (reciprocal space) rg_reciprocal	40.18 Å
I(0) (reciprocal space) i0_reciprocal	327600000.0000
Solution quality estimate total_estimate	0.8640
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	49.5 Å
Skewness Skewness skewness	0.400
Kurtosis Kurtosis kurtosis	-0.290
Angular range angular_range	— – 0.1950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	18250000.0000
Real-space data points n_real_points	40
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.844; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.895; Smooth: 0.801

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A
Molecular weight formula_weight	11343.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,I,J
Atom count atom_count	8973

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYSEPHESRTNTDILETLKRREHRG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Myocardin Enhancer DNA
Molecular weight formula_weight	6445.2 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E,G,K

AAGCACTTTCTTAAAATAGTG

Entity 3 Entity 3 polymer

Description description	Myocardin Enhancer DNA
Molecular weight formula_weight	6436.2 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F,H,L

CACTATTTTAAGAAAGTGCTT

Entity 4 Entity 4 polymer

Description description	Homeobox protein Nkx-2.5
Molecular weight formula_weight	7671.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O

RRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSKRQR

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	445

▶

8. Citations (1)

▶

Unit-cell length a length_a	69.370 Å
Unit-cell length b length_b	133.900 Å
Unit-cell length c length_c	140.040 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	70.120 Å
R factor r_factor	0.1876
R_work r_work	0.1857
R_free r_free	0.2247

fit	/app/data/saxs_computation/wc/6wc2/6wc2.fit
pddf	/app/data/pr_computation/wc/6wc2/6wc2.pr.out
profile	/app/data/saxs_computation/wc/6wc2/6wc2.dat

Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

State in the Current Structure

Other States of the Same Protein in the Database

MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A

State in the Current Structure

Other States of the Same Protein in the Database

Homeobox protein Nkx-2.5

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)