6xno

Crystal structure of E99A mutant of human CEACAM1

Method: X-RAY DIFFRACTION D_max: 71.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carcinoembryonic antigen-related cell adhesion molecule 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 35–141 Chain B； UniProt 35–141	Mutation：E99A	BOG octyl beta-D-glucopyranoside × 2 MLA MALONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 8；298 K；41% Tascimate with 0.5 % n-Octyl-D-glucoside pH 8.0	Resolution 1.90 Å R-free 0.223

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6XNO	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2GK2 Crystal structure of the N terminal domain of human CEACAM1 Deposited 2006-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 34–141（108 aa） Fragment：N terminal domain (residues 63-170)	Not recorded	NI NICKEL (II) ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；16% (w/v) polyethylene glycol mono methyl ether 2000, 100 mM Tris, and 5 mM nickel chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.258
2GK2 Crystal structure of the N terminal domain of human CEACAM1 Deposited 2006-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 34–141（108 aa） Fragment：N terminal domain (residues 63-170)	Not recorded	NI NICKEL (II) ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；16% (w/v) polyethylene glycol mono methyl ether 2000, 100 mM Tris, and 5 mM nickel chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.258
2GK2 Crystal structure of the N terminal domain of human CEACAM1 Deposited 2006-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 34–141（108 aa） Fragment：N terminal domain (residues 63-170) Chain B 34–141（108 aa） Fragment：N terminal domain (residues 63-170)	Not recorded	NI NICKEL (II) ION × 6 GOL GLYCEROL × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；16% (w/v) polyethylene glycol mono methyl ether 2000, 100 mM Tris, and 5 mM nickel chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.258
2GK2 Crystal structure of the N terminal domain of human CEACAM1 Deposited 2006-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 34–141（108 aa） Fragment：N terminal domain (residues 63-170) Chain B 34–141（108 aa） Fragment：N terminal domain (residues 63-170)	Not recorded	NI NICKEL (II) ION × 6 GOL GLYCEROL × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；16% (w/v) polyethylene glycol mono methyl ether 2000, 100 mM Tris, and 5 mM nickel chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.258
2GK2 Crystal structure of the N terminal domain of human CEACAM1 Deposited 2006-03-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 34–141（108 aa） Fragment：N terminal domain (residues 63-170) Chain B 34–141（108 aa） Fragment：N terminal domain (residues 63-170)	Not recorded	NI NICKEL (II) ION × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；294 K；16% (w/v) polyethylene glycol mono methyl ether 2000, 100 mM Tris, and 5 mM nickel chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.20 Å R-free 0.258
4QXW Crystal structure of the human CEACAM1 membrane distal amino terminal (N)-domain Deposited 2014-07-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 35–141（107 aa） Fragment：N terminal domain Chain B 35–141（107 aa） Fragment：N terminal domain	Not recorded	MLA MALONIC ACID × 1 BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；298 K；50 mM TrisHCL buffer 7.5, 60% Tascimate 8.0, 1% Beta-octyl glucoside, 12% Glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.04 Å R-free 0.242
4WHD Human CEACAM1 N-domain homodimer Deposited 2014-09-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 34–141（108 aa） Fragment：N-domain (UNP residues 34-141) Chain B 34–141（108 aa） Fragment：N-domain (UNP residues 34-141)	Not recorded	BOG octyl beta-D-glucopyranoside × 8 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；295 K；PEG 3000, NaCl, Phosphate-Citrate	Resolution 2.50 Å R-free 0.226
5DZL Crystal structure of the protein human CEACAM1 Deposited 2015-09-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 35–141（107 aa） Chain B 35–141（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；100 mM Tris 8.0, 25% PEG 3350, 12% glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.40 Å R-free 0.288
5DZL Crystal structure of the protein human CEACAM1 Deposited 2015-09-25	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 35–141（107 aa） Chain D 35–141（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；100 mM Tris 8.0, 25% PEG 3350, 12% glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.40 Å R-free 0.288
6AW2 Crystal structure of the HopQ-CEACAM1 complex Deposited 2017-09-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 34–141（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；20% PEG 6000, 0.1M HEPES , pH 7.5, 0.2M NaCl	Resolution 2.68 Å R-free 0.277
6GBG Helicobacter pylori adhesin HopQ type I bound to the N-terminal domain of human CEACAM1 Deposited 2018-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 35–142（108 aa）	Not recorded	BR BROMIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Condition B3 of the Morpheus HT-96 screen (Molecular Dimensions)(0.09 M Halogens mix (0.3M Sodium fluoride; 0.3M Sodium bromide; 0.3M Sodium iodide), 0.1 M Buffer System 1 (1.0M Imidazole; MES monohydrate (acid); pH 6.5), 50 % v/v Precipitant Mix 3 (40% v/v Glycerol; 20% w/v PEG 4000)	Resolution 2.80 Å R-free 0.263
6GBH Helicobacter pylori adhesin HopQ type II bound to the N-terminal domain of human CEACAM1 Deposited 2018-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 35–142（108 aa）	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；Condition A4 of the JB Screen Classic HTS II screen (Jena Bioscience) (1 M Ammonium sulfate, 100 mM Tris; pH 8.5)	Resolution 2.59 Å R-free 0.274
6GBH Helicobacter pylori adhesin HopQ type II bound to the N-terminal domain of human CEACAM1 Deposited 2018-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 35–142（108 aa）	Not recorded	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；Condition A4 of the JB Screen Classic HTS II screen (Jena Bioscience) (1 M Ammonium sulfate, 100 mM Tris; pH 8.5)	Resolution 2.59 Å R-free 0.274
6V3P The BIgI domain of beta protein from S. agalactiae bound to CEACAM1 Deposited 2019-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 34–141（108 aa）	Not recorded	SO4 SULFATE ION × 4 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.7M Ammonium Sulfate, 0.1M Sodium Citrate, pH 5.5	Resolution 3.25 Å R-free 0.244
6V3P The BIgI domain of beta protein from S. agalactiae bound to CEACAM1 Deposited 2019-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 34–141（108 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.7M Ammonium Sulfate, 0.1M Sodium Citrate, pH 5.5	Resolution 3.25 Å R-free 0.244
6XNT Crystal structure of I91A mutant of human CEACAM1 Deposited 2020-07-04	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 35–141（107 aa） Chain B 35–141（107 aa）	Mutation：I91A Mutation：I91A	BOG octyl beta-D-glucopyranoside × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；298 K；54% Tascimate with 0.5 % n-Octyl-D-glucoside pH 8.0	Resolution 3.10 Å R-free 0.258
6XNW Crystal structure of V39A mutant of human CEACAM1 Deposited 2020-07-04	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 35–141（107 aa） Chain B 35–141（107 aa）	Mutation：V39A Mutation：V39A	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.005 M Cobalt(II) chloride hexahydrate, 0.005 M Nickel(II) chloride hexahydrate, 0.005 M Cadmium chloride hydrate, 0.005 M Magnesium chloride hexahydrate with 12% w/v Polyethylene glycol 3,350 in 0.1 M HEPES pH 7.5 buffer	Resolution 1.90 Å R-free 0.186
6XNW Crystal structure of V39A mutant of human CEACAM1 Deposited 2020-07-04	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 35–141（107 aa） Chain D 35–141（107 aa）	Mutation：V39A Mutation：V39A	NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.005 M Cobalt(II) chloride hexahydrate, 0.005 M Nickel(II) chloride hexahydrate, 0.005 M Cadmium chloride hydrate, 0.005 M Magnesium chloride hexahydrate with 12% w/v Polyethylene glycol 3,350 in 0.1 M HEPES pH 7.5 buffer	Resolution 1.90 Å R-free 0.186
6XO1 Crystal structure of N97A mutant of human CEACAM1 Deposited 2020-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 35–141（107 aa）	Mutation：N97A	MLA MALONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；6% Tascimate with 25% polyethylene glycol 400 in 0.1 M MES monohydrate pH 6.0	Resolution 1.76 Å R-free 0.240
6XO1 Crystal structure of N97A mutant of human CEACAM1 Deposited 2020-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 35–141（107 aa）	Mutation：N97A	MLA MALONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；6% Tascimate with 25% polyethylene glycol 400 in 0.1 M MES monohydrate pH 6.0	Resolution 1.76 Å R-free 0.240
7MU8 Structure of the minimally glycosylated human CEACAM1 N-terminal domain Deposited 2021-05-14	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 35–141（107 aa） Chain B 35–141（107 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 GOL GLYCEROL × 10 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；100 mM MES, pH 6.5, 2M Ammonium sulfate	Resolution 1.70 Å R-free 0.217
7RPP Crystal structure of human CEACAM1 with GFCC' and ABED face Deposited 2021-08-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 35–141（107 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.2 M Ammonium sulfate, 0.1 M HEPES pH 7.5, 25% w/v Polyethylene glycol 3,350	Resolution 2.20 Å R-free 0.237
7RPP Crystal structure of human CEACAM1 with GFCC' and ABED face Deposited 2021-08-04	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 35–141（107 aa） Chain C 35–141（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.2 M Ammonium sulfate, 0.1 M HEPES pH 7.5, 25% w/v Polyethylene glycol 3,350	Resolution 2.20 Å R-free 0.237
8CXJ The IgI3 domain of R28 protein from S. pyogenes bound to CEACAM1 Deposited 2022-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 34–141（108 aa）	Not recorded	GOL GLYCEROL × 2 SO4 SULFATE ION × 4 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.45 M Ammonium sulfate 0.1M Na/K Phosphate pH 5.5	Resolution 3.05 Å R-free 0.238
8CXJ The IgI3 domain of R28 protein from S. pyogenes bound to CEACAM1 Deposited 2022-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 34–141（108 aa）	Not recorded	GOL GLYCEROL × 2 SO4 SULFATE ION × 4 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.45 M Ammonium sulfate 0.1M Na/K Phosphate pH 5.5	Resolution 3.05 Å R-free 0.238
8CXJ The IgI3 domain of R28 protein from S. pyogenes bound to CEACAM1 Deposited 2022-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 34–141（108 aa）	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.45 M Ammonium sulfate 0.1M Na/K Phosphate pH 5.5	Resolution 3.05 Å R-free 0.238
8CXJ The IgI3 domain of R28 protein from S. pyogenes bound to CEACAM1 Deposited 2022-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 34–141（108 aa）	Not recorded	SO4 SULFATE ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.45 M Ammonium sulfate 0.1M Na/K Phosphate pH 5.5	Resolution 3.05 Å R-free 0.238
9GH5 Complex of Fusobacterium nucleatum CbpF with human CEACAM1 Deposited 2024-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 35–428（394 aa） Chain E 35–428（394 aa） Chain F 35–428（394 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9GH6 CEACAM1 (35-234), focused refinement in the complex with CbpF Deposited 2024-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–428（428 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9U94 Cryo-EM structure of Fusobacterium nucleatum CbpF in complex with human CEACAM1 Deposited 2025-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 35–141（107 aa） Chain E 35–141（107 aa） Chain F 35–141（107 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.11 Å

17 other PDB entries and 30 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CEAM1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–107； UniProt 35–141 Author chain B； PDBConstruct 1–107； UniProt 35–141

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6xno
Deposition date deposition_date	2020-07-03
Structure title title	Crystal structure of E99A mutant of human CEACAM1
Keywords keywords	CEACAM1, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	19.53 Å
Radius of gyration Rg (electron density) rg_electron	18.94 Å
Forward intensity I(0) i0	10667500.00
Molecular weight molecular_weight	24453.0 kDa
Excluded volume excluded_volume	30641 Å³
Envelope volume envelope_volume	35045 Å³
Hydration-shell volume shell_volume	16346 Å³
Envelope diameter envelope_diameter	71.0 Å
Shell Rg shell_rg	24.14 Å
Envelope Rg envelope_rg	19.14 Å
Shape Rg shape_rg	18.91 Å
Total Rg total_rg	19.82 Å
Total atoms total_atoms	1728
Residues n_residues	214
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	71.1 Å
Rg (real space) rg_real	19.59 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	1.0670e+07
I(0) uncertainty (real space) i0_real_error	1.3130e+05
Rg (reciprocal space) rg_reciprocal	19.59 Å
I(0) (reciprocal space) i0_reciprocal	10670000.0000
Solution quality estimate total_estimate	0.8209
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	21.0 Å
Skewness Skewness skewness	0.463
Kurtosis Kurtosis kurtosis	-0.222
Angular range angular_range	— – 0.4050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4365000.0000
Real-space data points n_real_points	72
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.628; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.783; Smooth: 0.999

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Carcinoembryonic antigen-related cell adhesion molecule 1
Molecular weight formula_weight	11841.1 kDa
Mutation mutation	E99A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1814

QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEAATGQFHVY

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	octyl beta-D-glucopyranoside
Molecular weight formula_weight	292.4 kDa
Source method src_method	man
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	MALONIC ACID
Molecular weight formula_weight	104.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	86

▶

8. Citations (1)

▶

Unit-cell length a length_a	106.820 Å
Unit-cell length b length_b	106.820 Å
Unit-cell length c length_c	62.230 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	75.530 Å
R factor r_factor	0.1910
R_work r_work	0.1894
R_free r_free	0.2232

fit	/app/data/saxs_computation/xn/6xno/6xno.fit
pddf	/app/data/pr_computation/xn/6xno/6xno.pr.out
profile	/app/data/saxs_computation/xn/6xno/6xno.dat