7aeb

Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

baseplate protein (Algo12)

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	Baseplate_J domain-containing protein × 6 （A3HTB4） LysM domain-containing protein × 6 （A3HTB8） Putative tail lysozyme × 6 （A3HTB5） Phospholipid/glycerol acyltransferase × 6 （A3HTC0） Putative phage tail sheath protein FI × 6 （A3HTC2） Phage tail protein × 6 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTB3_9BACT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–933； UniProt 1–933 Author chain B； PDBConstruct 1–933； UniProt 1–933 Author chain C； PDBConstruct 1–933； UniProt 1–933 Author chain D； PDBConstruct 1–933； UniProt 1–933 Author chain E； PDBConstruct 1–933； UniProt 1–933 Author chain F； PDBConstruct 1–933； UniProt 1–933

Baseplate_J domain-containing protein

OrganismNot specified

UniProt A3HTB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	baseplate protein (Algo12) × 6 （A3HTB3） LysM domain-containing protein × 6 （A3HTB8） Putative tail lysozyme × 6 （A3HTB5） Phospholipid/glycerol acyltransferase × 6 （A3HTC0） Putative phage tail sheath protein FI × 6 （A3HTC2） Phage tail protein × 6 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTB4_9BACT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–1050； UniProt 1–1050 Author chain H； PDBConstruct 1–1050； UniProt 1–1050 Author chain I； PDBConstruct 1–1050； UniProt 1–1050 Author chain J； PDBConstruct 1–1050； UniProt 1–1050 Author chain K； PDBConstruct 1–1050； UniProt 1–1050 Author chain L； PDBConstruct 1–1050； UniProt 1–1050

LysM domain-containing protein

OrganismNot specified

UniProt A3HTB8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	baseplate protein (Algo12) × 6 （A3HTB3） Baseplate_J domain-containing protein × 6 （A3HTB4） Putative tail lysozyme × 6 （A3HTB5） Phospholipid/glycerol acyltransferase × 6 （A3HTC0） Putative phage tail sheath protein FI × 6 （A3HTC2） Phage tail protein × 6 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTB8_9BACT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–228； UniProt 1–228 Author chain N； PDBConstruct 1–228； UniProt 1–228 Author chain O； PDBConstruct 1–228； UniProt 1–228 Author chain P； PDBConstruct 1–228； UniProt 1–228 Author chain Q； PDBConstruct 1–228； UniProt 1–228 Author chain R； PDBConstruct 1–228； UniProt 1–228

Putative tail lysozyme

OrganismNot specified

UniProt A3HTB5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	baseplate protein (Algo12) × 6 （A3HTB3） Baseplate_J domain-containing protein × 6 （A3HTB4） LysM domain-containing protein × 6 （A3HTB8） Phospholipid/glycerol acyltransferase × 6 （A3HTC0） Putative phage tail sheath protein FI × 6 （A3HTC2） Phage tail protein × 6 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTB5_9BACT
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain S； PDBConstruct 1–137； UniProt 1–137 Author chain T； PDBConstruct 1–137； UniProt 1–137 Author chain U； PDBConstruct 1–137； UniProt 1–137 Author chain V； PDBConstruct 1–137； UniProt 1–137 Author chain W； PDBConstruct 1–137； UniProt 1–137 Author chain X； PDBConstruct 1–137； UniProt 1–137

Phospholipid/glycerol acyltransferase

OrganismNot specified

UniProt A3HTC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	baseplate protein (Algo12) × 6 （A3HTB3） Baseplate_J domain-containing protein × 6 （A3HTB4） LysM domain-containing protein × 6 （A3HTB8） Putative tail lysozyme × 6 （A3HTB5） Putative phage tail sheath protein FI × 6 （A3HTC2） Phage tail protein × 6 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC0_9BACT
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain Y； PDBConstruct 1–147； UniProt 1–147 Author chain Z； PDBConstruct 1–147； UniProt 1–147 Author chain a； PDBConstruct 1–147； UniProt 1–147 Author chain b； PDBConstruct 1–147； UniProt 1–147 Author chain c； PDBConstruct 1–147； UniProt 1–147 Author chain d； PDBConstruct 1–147； UniProt 1–147

Putative phage tail sheath protein FI

OrganismNot specified

UniProt A3HTC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	baseplate protein (Algo12) × 6 （A3HTB3） Baseplate_J domain-containing protein × 6 （A3HTB4） LysM domain-containing protein × 6 （A3HTB8） Putative tail lysozyme × 6 （A3HTB5） Phospholipid/glycerol acyltransferase × 6 （A3HTC0） Phage tail protein × 6 （A3HTC1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC2_9BACT
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain e； PDBConstruct 1–692； UniProt 1–692 Author chain f； PDBConstruct 1–692； UniProt 1–692 Author chain g； PDBConstruct 1–692； UniProt 1–692 Author chain h； PDBConstruct 1–692； UniProt 1–692 Author chain i； PDBConstruct 1–692； UniProt 1–692 Author chain j； PDBConstruct 1–692； UniProt 1–692

Phage tail protein

OrganismNot specified

UniProt A3HTC1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	baseplate protein (Algo12) × 6 （A3HTB3） Baseplate_J domain-containing protein × 6 （A3HTB4） LysM domain-containing protein × 6 （A3HTB8） Putative tail lysozyme × 6 （A3HTB5） Phospholipid/glycerol acyltransferase × 6 （A3HTC0） Putative phage tail sheath protein FI × 6 （A3HTC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A3HTC1_9BACT
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain k； PDBConstruct 1–142； UniProt 1–142 Author chain l； PDBConstruct 1–142； UniProt 1–142 Author chain m； PDBConstruct 1–142； UniProt 1–142 Author chain n； PDBConstruct 1–142； UniProt 1–142 Author chain o； PDBConstruct 1–142； UniProt 1–142 Author chain p； PDBConstruct 1–142； UniProt 1–142

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7aeb
Deposition date deposition_date	2020-09-17
Structure title title	Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry.
Keywords keywords	extracellular contractile injection system, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7aeb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7aeb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7aeb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	95.35 Å
Rg (electron density)	94.42 Å
Total Rg	94.51 Å
Atom count	135156
Residues	17154
Excluded volume	2404400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7aeb__assembly_1__model_1`	42-meric （42）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	baseplate protein (Algo12)
Molecular weight formula_weight	107771.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	135156

MSTLNKHISIPKDMSSKDDLDFHFLREEGIRYIKELGSNFWTDYNTHDPGITMLEVLCYAISDLGNRINIPIEDLIANEEGGVKGQFYKVQEILPSAPTSELDLRKLFIDIEGIKNCWIKRERVTVFADLKNQKLSYEKTIWEDLKENQKAQFDLKGLYRILVETEDADKVLSESLEKAVFTKFHANRNLCEDLIKVEKVATEPISVCANVEVAPEADEELIHAQILIAIEDYLAPSPRHYSLKQMVDKGYTMDEIFEGPFLENGFIDTVELKASELRKEVRLSDIINIIMSIDGVKIVKEITLGNCDENDGIENNQWVICIPENKKPKLCKKTTINYFKGILPINLNPVRVDNHKSKILASRLENDLKAKDDLEPAIPQGTFADWGEYSSIQHEFPETYGISDIGLPPKLGVKRAVLARQLKGYLLFFDQILASYFEHLSKIKSLLSLDQGPSFTYFTQAIKDIKDVEELFKDPTLLENDEELTKSLIGKLDDTIERRNQLMDHLIARFAENFSSYAFLMKFLYGESTDEIVLQDKQSFLREYKEISRERGEGFNFYEQSNDNLWDTLNVSGAQKRISKLVGVKDYSRRNLSDTAVEIYRYEHVDGNWVYRWRIRDENGKVLLSATTSYPTYNSAGNEMYFAILKILETPLSDLEKLLEVNFRNENEAGSFHFHKAATSNKFSFDIINPVIDSESSSDFIVAKQYTYYPDRTQAVLGAISLLNFIKYTFTEEGIYLVEHILLRPSPLDPEYLAMQTDAGKEYIEGNFLPFCSDDYENCKMIDPYSFRVSIVLPGFTYRFANKDFRDYLENLIREELPAHIVAKICWIGYRKGEEPELFQEDVENPETPIFKENQLEIFEKAYKNYLFELTDIHKRKGFIASMNKYNQVLNEMTSSLTGLHTIYPTGRLYDCEDEEEELDGKLILGKTNLGTL

Entity 2 Entity 2 polymer

Description description	Baseplate_J domain-containing protein
Molecular weight formula_weight	119379.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

MSENCNHIVTTLKRDGTGRRDLLDPKLAPESVQLQDFELSDWLIFALNFARKIHFFPSDLANEPLGDWRNFFSTIVSDKTLISDIENLDDFEKLRGNIEEFLAAYDQSGKLTPHLTLFVSFLKLLETSKKRFNQLTKRHLDFYYQEILHLEKQALSPDHVFLIFELAKNVSQEKLDEGTEVDGGKDDTGKKNTYLTSFETVLNKTKVGQLKSLYNEISVEKEEIKELNTPISTGTFVMAPMANSFDGLGEDFPKGSEKWWPFGYTKICNASTVLPALPKARLGCSISSKLLKLSEGTRDIILEFTFNKPILPNGEDYTALNKAMSIELTGEKGWIAGLPMTLKSDSGINSGSKKMKLSLTLDSEQPAVVPYQTELHEGSYEVDEPLLRVLFKTNEKEGYNLYRLFNENVLTDLKITVEVSDITSVQLENDLGVLNPQKPFFPFGPRPIKGSSFIVKYPEAMEKPVTAISYQMDYLNLPENLVNHYSAYTIGDDEPLVSDMDYFSVKSFPKSSNDSDQLFSEKSGGGYESDFEFQIENGVWESGLKKELKISLERSFLHEKYAHYFTLVAISKDTDPTIELLPNEPYAPLAENLVLGYTAISSIDFSSSSSENQVSLIHEMPFGFQQVFTPGDTDNSLYLVPDYCHGGELYIGLENGKNLQQVTLLLQFLEGSENPDITDIFTGNQKIKWQYLSQNQWQDFQSGEIIQNQTPRFLKSGIFQFSIPKQANLDNTVLPPGYHWIKASMVKPFDVVSQLINIHAQAVEAVFEDQGSSGNHLEKGLPAETISKLQERLSWIKSIQQPYPSTKGKAQESDEDYYRRVSERLRHKKRAITLWDYEHLILQKFPKVYKVKCLNHTCSSSFQSPGNATLILVPDTVQQSVFDIYQPRVSQGTLNDVAAFVNELNSFHVQAKVINPNYEEVKVDVKVKFREGLDVSFYLTKVKEDIKKFLSPWAYDQESSVEFGVTLHRSQMIHYLEQLTYVDYITDLRLLKRQAGSSPCNPIFIETTEKEYIQPSNPKSILVSAKEHLVTPITQNCSSISLNNEEECQH

Entity 3 Entity 3 polymer

Description description	LysM domain-containing protein
Molecular weight formula_weight	26571.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O,P,Q,R

MSEGKLEKLRIVAYKDSKFSDEVENGEFITLLNPEKYKFQYRVEQNEDQASGTSSAPIRFNKILPQTLEFDFLFDRTGVIAGYEVTEDGIINDIDHFKKVVYDYNGEKHKPNYLMITWGSLLFKGYLKEMDIEYKLFRPDGTPIRAMATTKIGEFVEEELRTAQENNQSPDMSHYRTVKEGDTLPLMTYRIYGDSKYYLEVAKANGLTNFRRLKTGTELIFPPLQKQK

Entity 4 Entity 4 polymer

Description description	Putative tail lysozyme
Molecular weight formula_weight	15762.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U,V,W,X

MMEKSKDFLGTGWGFPPEFETSIGQVKTTSGVEDIQKSLEILFSTKIGERIMQPTYGCNLDELLFSPINRTLKTYVIELIKNAILYHEPRIDPEKIDITQGNEIEGELLIHLQYIVRATNSRKNMVYPFYLEEGTNI

Entity 5 Entity 5 polymer

Description description	Phospholipid/glycerol acyltransferase
Molecular weight formula_weight	17063.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z,a,b,c,d

MATYYPPSSFHFLVEFTGIDAKNNDHEFQSVSGLSVDIDTEEFAEGGENRFKHKFPVKTKYPNLVLKRGVLVDSKVISWCRDAIEDFEFKPIDLTVKLLNEEHQPLMTWNVVHAYPVKWSVEDFNAQESKMAIESVELSYNYFKTIV

Entity 6 Entity 6 polymer

Description description	Putative phage tail sheath protein FI
Molecular weight formula_weight	76319.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g,h,i,j

MATYKTPGVYIEEITKFPPSVAQVETAIPAFIGYTQFARTKPSVDSDDLILKPKRISSLLDFTTYYGGAQNEQGITVKLTDTLIEGAENRTINVPEPTFKSPYLMFYSLQMYFANGGGPCYIVSTGVYDDWSDSETPPTINFSDLESGLAVIRKEDEPTLLLFPDATNLPTDDEFYSLYNSALMQCNDLQDRFTILDTYSDQTYNDGVEDLDPIPALRNGINLTKDYLKYGAAYYPFVQTILNYQYSADEIVIQHLSYNPNAIATALDNLNAVNGPTFIDAILDDLRDLSLPDISGEISDAVGFMYDDVDGFDIDGTFTTNSVKVANFASLVESVLSTLNELIDAKEEINKDVNSAIASSEEDNAIKTAISDALDVFNEDFEGADKIESVAKNLSDLLIKIKQADTNTKVENVLSINALNFSAEFEKLLTYDVNTGLTASVTLDLFANIGTRLDDIIAAVSAAEPIDVNNGKLNGRLLSDIEPLDNATYNTILLEINSHKVTLPPSSSMAGAYARVDNDRGVWKSPANIGLNYVSKPSVTVSHEEQESMNVHGTGKSVNAIRSFVGKGTLVWGARTLAGNDNEWRYISVRRFFNMAEESIKKATEQFVFEPNDGNTWVRVRAMIENFLILQWRAGALAGAKPEHAFYVKVGLGQTMTAQDILEGNMNVEIGLAVVRPAEFIILKFSHKMQES

Entity 7 Entity 7 polymer

Description description	Phage tail protein
Molecular weight formula_weight	16375.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,l,m,n,o,p

MSYPLSKFHFSVEWGGTKIGFTEVSGLDLETEIIEYRHGASPEYSKIKMPGMQKFSNITLKRGTFKSDNEYFQWYNTINLNKVERRDLTISLLNEEHEPVVTWKVKNAWPLKVQSTDLKGDGNEVAIESMELAHEGLVIQNE

▶

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	82969

Cryo-EM structure of an extracellular contractile injection system in marine bacterium Algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry.

1. Protein Identity and Related Structures Protein Identity & Related Structures

baseplate protein (Algo12)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate_J domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LysM domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative tail lysozyme

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phospholipid/glycerol acyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative phage tail sheath protein FI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phage tail protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7aeb__assembly_1__model_1

7aeb__assembly_1__model_1 | I(q)

7aeb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer