7e0i

LHCII-2 in the state transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardti

Method: ELECTRON MICROSCOPY D_max: 99.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain U； UniProt 1–257	Not recorded	Chlorophyll a-b binding protein, chloroplastic × 1 （Q9ZSJ4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q93WE0） CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.53 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7E0I	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6KAC Cryo-EM structure of the C2S2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii Deposited 2019-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain N 1–257（257 aa） Chain n 1–257（257 aa）	Not recorded	OEX CA-MN4-O5 CLUSTER × 2 FE2 FE (II) ION × 2 CL CHLORIDE ION × 4 CLA CHLOROPHYLL A × 148 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BCT BICARBONATE ION × 2 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2 LMU DODECYL-ALPHA-D-MALTOSIDE × 6 CHL CHLOROPHYLL B × 50 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
6KAD Cryo-EM structure of the C2S2M2L2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii Deposited 2019-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain 2 1–257（257 aa） Chain 3 1–257（257 aa） Chain 5 1–257（257 aa） Chain 8 1–257（257 aa） Chain 9 1–257（257 aa） Chain N 1–257（257 aa） Chain n 1–257（257 aa） Chain p 1–257（257 aa）	Not recorded	CHL CHLOROPHYLL B × 122 CLA CHLOROPHYLL A × 254 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 22 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 OEX CA-MN4-O5 CLUSTER × 2 FE2 FE (II) ION × 2 CL CHLORIDE ION × 2 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BCT BICARBONATE ION × 2 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6KAF C2S2M2N2-type PSII-LHCII Deposited 2019-06-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain 1 1–257（257 aa） Chain 2 1–257（257 aa） Chain 3 1–257（257 aa） Chain 4 1–257（257 aa） Chain 5 1–257（257 aa） Chain 6 1–257（257 aa） Chain G 1–257（257 aa） Chain N 1–257（257 aa） Chain P 1–257（257 aa） Chain Q 1–257（257 aa） Chain U 1–257（257 aa） Chain V 1–257（257 aa） Chain g 1–257（257 aa） Chain n 1–257（257 aa） Chain p 1–257（257 aa） Chain q 1–257（257 aa） Chain u 1–257（257 aa） Chain v 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 252 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 30 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 40 CHL CHLOROPHYLL B × 122 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 16 FE2 FE (II) ION × 2 CL CHLORIDE ION × 4 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 22 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 4 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 BCT BICARBONATE ION × 2 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.73 Å
7D0J Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain P 38–256（219 aa） Chain Q 38–256（219 aa） Chain R 38–256（219 aa） Chain T 38–256（219 aa） Chain U 38–256（219 aa）	Not recorded	CLA CHLOROPHYLL A × 276 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BCR BETA-CAROTENE × 37 SF4 IRON/SULFUR CLUSTER × 3 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHL CHLOROPHYLL B × 56 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain U 1–257（257 aa） Chain Y 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain U 1–257（257 aa） Chain Y 1–257（257 aa） Chain Z 1–257（257 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7E0H LHCII-1 in the state transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-28	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 1–257（257 aa） Chain Z 1–257（257 aa）	Not recorded	CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.75 Å
7E0J LHCII-1 in the state transition supercomplex PSI-LHCI-LHCII from the double phosphatase mutant pph1;pbcp of Chlamydomonas reinhardti. Deposited 2021-01-28	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 1–257（257 aa）	Not recorded	CHL CHLOROPHYLL B × 17 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
7E0K LHCII-2 in the state transition supercomplex PSI-LHCI-LHCII from the double phosphatase mutant pph1;pbcp of Chlamydomonas reinhardti. Deposited 2021-01-28	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain U 1–257（257 aa）	Not recorded	CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9IS4 Cryo-EM structure of a TEF30-associated intermediate C2S-type PSII-LHCII supercomplex from Chlamydomonas reinhardtii Deposited 2024-07-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain N 39–257（219 aa）	Not recorded	FE2 FE (II) ION × 2 CLA CHLOROPHYLL A × 109 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 LMU DODECYL-ALPHA-D-MALTOSIDE × 4 BCT BICARBONATE ION × 2 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2 CHL CHLOROPHYLL B × 25 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 5 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q93WL4_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain U； PDBConstruct 1–257； UniProt 1–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q9ZSJ4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain V； UniProt 1–268	Non-standard monomer：Yes (specific site not provided by mmCIF)	Chlorophyll a-b binding protein, chloroplastic × 1 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q93WE0） CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.53 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E0I	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain V 1–268（268 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain V 1–268（268 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7E0K LHCII-2 in the state transition supercomplex PSI-LHCI-LHCII from the double phosphatase mutant pph1;pbcp of Chlamydomonas reinhardti. Deposited 2021-01-28	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain V 1–268（268 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9ZSJ4_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain V； PDBConstruct 1–268； UniProt 1–268

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93WE0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain W； UniProt 1–249	Not recorded	Chlorophyll a-b binding protein, chloroplastic × 1 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q9ZSJ4） CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.53 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7E0I	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6KAC Cryo-EM structure of the C2S2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii Deposited 2019-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain G 1–249（249 aa） Chain g 1–249（249 aa）	Not recorded	OEX CA-MN4-O5 CLUSTER × 2 FE2 FE (II) ION × 2 CL CHLORIDE ION × 4 CLA CHLOROPHYLL A × 148 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 4 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 18 BCT BICARBONATE ION × 2 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2 LMU DODECYL-ALPHA-D-MALTOSIDE × 6 CHL CHLOROPHYLL B × 50 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
6KAD Cryo-EM structure of the C2S2M2L2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii Deposited 2019-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 58 PDB declaration: 58-meric	Chain 4 1–249（249 aa） Chain G 1–249（249 aa） Chain g 1–249（249 aa） Chain q 1–249（249 aa）	Not recorded	CHL CHLOROPHYLL B × 122 CLA CHLOROPHYLL A × 254 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 20 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 22 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 OEX CA-MN4-O5 CLUSTER × 2 FE2 FE (II) ION × 2 CL CHLORIDE ION × 2 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BCT BICARBONATE ION × 2 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7DZ7 State transition supercomplex PSI-LHCI-LHCII from double phosphatase mutant pph1;pbcp of green alga Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain W 1–249（249 aa） Chain X 1–249（249 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
7DZ8 State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain W 1–249（249 aa） Chain X 1–249（249 aa）	Not recorded	CLA CHLOROPHYLL A × 298 PQN PHYLLOQUINONE × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 27 BCR BETA-CAROTENE × 40 SF4 IRON/SULFUR CLUSTER × 3 LMU DODECYL-ALPHA-D-MALTOSIDE × 7 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 11 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 22 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 8 CHL CHLOROPHYLL B × 36	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
7E0H LHCII-1 in the state transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii Deposited 2021-01-28	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain X 1–249（249 aa）	Not recorded	CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.75 Å
7E0J LHCII-1 in the state transition supercomplex PSI-LHCI-LHCII from the double phosphatase mutant pph1;pbcp of Chlamydomonas reinhardti. Deposited 2021-01-28	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain X 1–249（249 aa）	Not recorded	CHL CHLOROPHYLL B × 17 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
7E0K LHCII-2 in the state transition supercomplex PSI-LHCI-LHCII from the double phosphatase mutant pph1;pbcp of Chlamydomonas reinhardti. Deposited 2021-01-28	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain W 1–249（249 aa）	Not recorded	CHL CHLOROPHYLL B × 18 CLA CHLOROPHYLL A × 24 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 3 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 3 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9IS4 Cryo-EM structure of a TEF30-associated intermediate C2S-type PSII-LHCII supercomplex from Chlamydomonas reinhardtii Deposited 2024-07-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 38 PDB declaration: 38-meric	Chain G 31–249（219 aa）	Not recorded	FE2 FE (II) ION × 2 CLA CHLOROPHYLL A × 109 PHO PHEOPHYTIN A × 4 BCR BETA-CAROTENE × 20 SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 3 LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 15 DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 8 LMU DODECYL-ALPHA-D-MALTOSIDE × 4 BCT BICARBONATE ION × 2 PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 2 CHL CHLOROPHYLL B × 25 LUT (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 8 NEX (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL × 5 XAT (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q93WE0_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain W； PDBConstruct 1–249； UniProt 1–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7e0i
Deposition date deposition_date	2021-01-28
Structure title title	LHCII-2 in the state transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardti
Keywords keywords	Supercomplex, LHCII, state transition, green alga, Chlamydomonas reinhardtii, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.68 Å
Radius of gyration Rg (electron density) rg_electron	28.65 Å
Forward intensity I(0) i0	122124000.00
Molecular weight molecular_weight	112230.0 kDa
Excluded volume excluded_volume	149620 Å³
Envelope volume envelope_volume	168310 Å³
Hydration-shell volume shell_volume	46377 Å³
Envelope diameter envelope_diameter	105.6 Å
Shell Rg shell_rg	37.87 Å
Envelope Rg envelope_rg	28.94 Å
Shape Rg shape_rg	28.62 Å
Total Rg total_rg	29.82 Å
Total atoms total_atoms	8033
Residues n_residues	676
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	99.0 Å
Rg (real space) rg_real	30.44 Å
Rg uncertainty (real space) rg_real_error	0.61 Å
I(0) (real space) i0_real	1.2210e+08
I(0) uncertainty (real space) i0_real_error	1.8890e+06
Rg (reciprocal space) rg_reciprocal	30.55 Å
I(0) (reciprocal space) i0_reciprocal	122100000.0000
Solution quality estimate total_estimate	0.8697
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	41.9 Å
Skewness Skewness skewness	0.034
Kurtosis Kurtosis kurtosis	-0.338
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	10130000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.778; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.982; Smooth: 0.986

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27405.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U
Atom count atom_count	8033

MAFALSFSRKALQVSAKATGKKGTGKTAAKQAPASSGIEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLSNPTVNNAFAFATKFTPSA

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28796.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MMLSRTVVNVQAKLTKKGGAPKKAAPASAQKKTIREKAGWWSNGGNEKLSAFYGPDRGLWLGPLSGTTPAYLTGEFPGDYGWDSAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKNGTPIVEPVWFKAGAQIFAEGGLDYLGNPGLVHAQSILATLAVQVILMGAIEGYRVNGGPAGEGLDKLHPGGQFFDPLGLAEDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLANLDEHLASPFTSNAFTYAQKFTPQ

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	26675.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKNGIPFGEAVWFKAGAQIFAEGGLNYLGNENLIHAQSIIATLAFQVVVMGLAEAYRANGGPLGEGLDPLHPGGAFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLANPTAVNAFAYATKFTPSA

Entity 4 Entity 4 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 5 Entity 5 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 6 Entity 6 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 8 Entity 8 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 9 Entity 9 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 10 Entity 10 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.53 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	123997

fit	/app/data/saxs_computation/e0/7e0i/7e0i.fit
pddf	/app/data/pr_computation/e0/7e0i/7e0i.pr.out
profile	/app/data/saxs_computation/e0/7e0i/7e0i.dat

LHCII-2 in the state transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardti

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)