7d0j

Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–740； UniProt 12–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P09144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 2–735

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q00914

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt Q39615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–144； UniProt 53–196

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–63； UniProt 34–96

Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 63–227

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P14224

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–91； UniProt 32–122

Photosystem I reaction center subunit VI, chloroplastic

OrganismNot specified

UniProt P13352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAH_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–100； UniProt 31–130

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A8IFG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 68–104

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P59777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–41； UniProt 1–41

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P14225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–85； UniProt 29–113

PSI subunit V

OrganismNot specified

UniProt A8IL32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IL32_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–159； UniProt 38–196

Photosystem I subunit O

OrganismNot specified

UniProt A8JCL6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JCL6_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–93； UniProt 31–123

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93WL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93WL4_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–219； UniProt 38–256 Author chain Q； PDBConstruct 1–219； UniProt 38–256 Author chain R； PDBConstruct 1–219； UniProt 38–256 Author chain T； PDBConstruct 1–219； UniProt 38–256 Author chain U； PDBConstruct 1–219； UniProt 38–256

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8J264

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J264_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain S； PDBConstruct 1–234； UniProt 21–254

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q7DM26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7DM26_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 1； PDBConstruct 1–194； UniProt 31–224 Author chain a； PDBConstruct 1–194； UniProt 31–224

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8IKC8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IKC8_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 2； PDBConstruct 1–201； UniProt 28–228

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8JF10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JF10_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 3； PDBConstruct 1–203； UniProt 61–263

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 4； PDBConstruct 1–205； UniProt 58–262

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 5； PDBConstruct 1–225； UniProt 32–256

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 6； PDBConstruct 1–230； UniProt 28–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY4_CHLRE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain 7； PDBConstruct 1–213； UniProt 29–241

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 8； PDBConstruct 1–217； UniProt 27–243

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q8S567

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 29	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VI, chloroplastic × 1 （P13352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） PSI subunit V × 1 （A8IL32） Photosystem I subunit O × 1 （A8JCL6） Chlorophyll a-b binding protein, chloroplastic × 5 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 1 （A8J264） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY4） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） CHLOROPHYLL A × 276 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 20 BETA-CAROTENE × 37 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 10 CHLOROPHYLL B × 56 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 34 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 6 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8S567_CHLRE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 9； PDBConstruct 1–182； UniProt 29–210

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7d0j
Deposition date deposition_date	2020-09-10
Structure title title	Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii
Keywords keywords	PSI-LHCI-LHCII, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7d0j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7d0j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7d0j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	77.59 Å
Rg (electron density)	78.29 Å
Total Rg	77.82 Å
Atom count	68860
Residues	5922
Excluded volume	1290400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7d0j__assembly_1__model_1`	29-meric （29）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (36)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	81992.8 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	68860

KVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82053.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ATKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8738.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

AHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	16123.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	7021.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

EVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAA

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	9572.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQG

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VI, chloroplastic
Molecular weight formula_weight	11053.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

KYGENSRYFDLQDMENTTGSWDMYGVDEKKRYPDNQAKFFTQATDIISRRESLRALVALSGIAAIVTYGLKGAKDADLPITKGPQTTGENGKGGSVRSRL

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3970.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

PFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAP

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4750.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFSF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	8259.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

FIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL

Entity 12 Entity 12 polymer

Description description	PSI subunit V
Molecular weight formula_weight	16449.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

KKAQVISPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGSAQFQSTPSIGVKTLSGRSVARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQILPYYS

Entity 13 Entity 13 polymer

Description description	Photosystem I subunit O
Molecular weight formula_weight	10129.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

ASNKSFPRDWVKTDPLVPVLGFAGWTIPANIGVSAFGGQSLFGLFTQSIGENLAHFPTGPALDDKFWLYLITYHLGLFLTITLGQIGVQGRKQ

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23690.7 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,R,T,U

IEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLSNPTVNNAFAFATKFTPS

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25157.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

KKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENSTPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCLTPELLAKNGTKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATLAVQVILMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPVQNLDDHLANPTVNNAFAFATKFTPSA

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	20368.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,a

KAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	21986.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

RPMWYPGATAPAHLDGSMLGDYGFDPLRLGVNKDNLKWFREAELTNGRWAMAAVVGILFTDAVGLPKFWTAGAEKYALDNQTLALIEVAVFAVLEGKRYEIYKKTGETGFLSFAPFDPMGMKSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGPIETLQLHLADPGHNNIYTSSVGPETAVTVAVLCVLPMIIEATKTLN

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22090.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

LPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFA

Entity 19 Entity 19 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22490.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

LPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLA

Entity 20 Entity 20 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	24879.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

RKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGS

Entity 21 Entity 21 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25025.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

SRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Entity 22 Entity 22 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23305.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

VRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSNPIA

Entity 23 Entity 23 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23293.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

RQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Entity 24 Entity 24 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	19772.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

PTWLPGLNPPAHLKGALAGDNGFDPLGLGQDEGRLKWYAEAEKTNGRWAMMAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIVMGFLEIKRYQGFKQTGTSGFINSFPFDPAGMNSPSMATKEVKNGRLAMVAFIGFCVQALATRTQPIEGLTAHLADPFGKNITYYLTHLPETL

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	276

Entity 26 Entity 26 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 28 Entity 28 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	37

Entity 29 Entity 29 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 30 Entity 30 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 33 Entity 33 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	56

Entity 34 Entity 34 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	34

Entity 35 Entity 35 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 36 Entity 36 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	6

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	7d0j301
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7d0j401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7d0j501
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7d0j701
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7d0j801
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7d0j901
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7d0jL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	7d0jS01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.42 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	283763

Photosystem I-LHCI-LHCII of Chlamydomonas reinhardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit V, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VI, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer