7r3k

Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P09144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–735； UniProt 1–735

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q00914

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt Q39615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–196； UniProt 1–196

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–97； UniProt 1–97

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–227； UniProt 1–227

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P14224

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–126； UniProt 1–126

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A8IFG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–106； UniProt 1–106

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P59777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–41； UniProt 1–41

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P14225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–113； UniProt 1–113

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q05093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q05093_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 1； PDBConstruct 1–228； UniProt 1–228 Author chain Z； PDBConstruct 1–228； UniProt 1–228

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8JF10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JF10_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 3； PDBConstruct 1–298； UniProt 1–298

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q84Y02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84Y02_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 7； PDBConstruct 1–241； UniProt 1–241

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 8； PDBConstruct 1–243； UniProt 1–243

Chlorophyll a-b binding protein, chloroplastic (Lhca4)

OrganismNot specified

UniProt Q75VZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 4； PDBConstruct 1–264； UniProt 1–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 5； PDBConstruct 1–257； UniProt 1–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 1 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 186 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 28 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 12 DODECYL-BETA-D-MALTOSIDE × 16 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 CALCIUM ION × 1 (3R)-beta,beta-caroten-3-ol × 3 ;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ; × 3 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 LAURIC ACID × 1 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 14 CHLOROPHYLL B × 28 SPHINGOSINE × 3 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 4 DIACYL GLYCEROL × 1 PALMITIC ACID × 1 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 ERGOSTEROL × 2 water × 17	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 6； PDBConstruct 1–257； UniProt 1–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7r3k
Deposition date deposition_date	2022-02-07
Structure title title	Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex
Keywords keywords	Photosystem I, Complex, Green algae, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7r3k__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7r3k__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7r3k__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.43 Å
Rg (electron density)	58.90 Å
Total Rg	58.90 Å
Atom count	45934
Residues	3854
Excluded volume	866000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7r3k__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (39)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83239.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	46504

MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82184.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8869.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	21401.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	10786.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MQALSSRVNIAAKPQRAQRLVVRAEEVKAAPKKEVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	24088.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MALTMRNPAVKASSRVAPSSRRALRVACQAQKNETASKVGTALAASALAAAVSLSAPSAAMADIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	13236.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MQTLASRPSLRASARVAPRRAPRVAVVTKAALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	10586.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MALRAVSAKSAVRPTVARASVKPVAALKPAQKMALAGAASVALLAASSSSAEASQVIATVASAAQGYPFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAPSS

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4750.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFSF

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	11214.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MQALATRPSAIRPTKAARRSSVVVRADGFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL

Entity 11 Entity 11 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23923.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,Z

MALSMRTLSARTAAPRGFSGRRVAAVSNGSRVTMKAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	32629.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MMLTKSAQAAFSGKVARPAKANRARLVCRAEEKSIAKVDRSKDQLYVGASQSSLAYLDGSLPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFAGRVSGSSQPWRPHGWWRRRYRSVAALALIRNRSVC

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	26248.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MALSMIAQRRAGAFSARQAPRAVRAQAAVRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSIPIA

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25948.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MALTMKRSGVAARSASSRKSVVTCVARQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic (Lhca4)
Molecular weight formula_weight	28729.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAFVLAKSSAFGVAAKPVSRRSSVAVKASAVPENVKEAREWIDAWKSKSGGAKRDAALPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLARL

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28257.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MAALMQKSALSRPACSTRSSRRAVVVRAAADRKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGSQ

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27812.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MMLVAKNAVAARPSARSARRSVVAKASSRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Entity 18 Entity 18 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	186

Entity 20 Entity 20 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 22 Entity 22 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 23 Entity 23 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 24 Entity 24 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 25 Entity 25 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 26 Entity 26 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 27 Entity 27 non-polymer

Description description	(3R)-beta,beta-caroten-3-ol
Molecular weight formula_weight	552.9 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 28 Entity 28 non-polymer

Description description	;(1~{S})-3,5,5-trimethyl-4-[(1~{E},3~{E},5~{E},7~{E},9~{E},11~{E},13~{E},15~{E},17~{E})-3,7,12,16-tetramethyl-18-[(4~{S})-2,6,6-trimethyl-4-oxidanyl-cyclohexen-1-yl]octadeca-1,3,5,7,9,11,13,15,17-nonaenyl]cyclohex-3-en-1-ol ;
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 29 Entity 29 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 30 Entity 30 non-polymer

Description description	LAURIC ACID
Molecular weight formula_weight	200.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 32 Entity 32 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 33 Entity 33 non-polymer

Description description	SPHINGOSINE
Molecular weight formula_weight	299.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 34 Entity 34 non-polymer

Description description	1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
Molecular weight formula_weight	705.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 35 Entity 35 non-polymer

Description description	DIACYL GLYCEROL
Molecular weight formula_weight	625.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 36 Entity 36 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 37 Entity 37 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 38 Entity 38 non-polymer

Description description	ERGOSTEROL
Molecular weight formula_weight	396.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	570

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.52 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	173187

Chlamydomonas reinhardtii TSP9 mutant small Photosystem I complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit V, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit psaK, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer