7zqd

Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751 Author chain A2； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P09144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–735； UniProt 1–735 Author chain B2； PDBConstruct 1–735； UniProt 1–735

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q00914

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81 Author chain C2； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt Q39615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–196； UniProt 1–196 Author chain D2； PDBConstruct 1–196； UniProt 1–196

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–97； UniProt 1–97 Author chain E2； PDBConstruct 1–97； UniProt 1–97

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–227； UniProt 1–227 Author chain F2； PDBConstruct 1–227； UniProt 1–227

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P14224

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–126； UniProt 1–126 Author chain G2； PDBConstruct 1–126； UniProt 1–126

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A8IFG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–106； UniProt 1–106 Author chain I2； PDBConstruct 1–106； UniProt 1–106

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P59777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain J2； PDBConstruct 1–40； UniProt 1–40

PSI subunit V

OrganismNot specified

UniProt A8IL32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IL32_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–196； UniProt 1–196 Author chain L2； PDBConstruct 1–196； UniProt 1–196

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P14225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–113； UniProt 1–113 Author chain K2； PDBConstruct 1–113； UniProt 1–113

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q05093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q05093_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 1； PDBConstruct 1–228； UniProt 1–228 Author chain 12； PDBConstruct 1–228； UniProt 1–228 Author chain Z； PDBConstruct 1–228； UniProt 1–228 Author chain Z2； PDBConstruct 1–228； UniProt 1–228

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8JF10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JF10_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 3； PDBConstruct 1–298； UniProt 1–298 Author chain 32； PDBConstruct 1–298； UniProt 1–298

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q84Y02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84Y02_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 7； PDBConstruct 1–241； UniProt 1–241 Author chain 72； PDBConstruct 1–241； UniProt 1–241

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 8； PDBConstruct 1–243； UniProt 1–243 Author chain 82； PDBConstruct 1–243； UniProt 1–243

Chlorophyll a-b binding protein, chloroplastic (Lhca4)

OrganismNot specified

UniProt Q75VZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 4； PDBConstruct 1–264； UniProt 1–264 Author chain 42； PDBConstruct 1–264； UniProt 1–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 5； PDBConstruct 1–257； UniProt 1–257 Author chain 52； PDBConstruct 1–257； UniProt 1–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （A8ITV3） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 6； PDBConstruct 1–257； UniProt 1–257 Author chain 62； PDBConstruct 1–257； UniProt 1–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8ITV3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q05093） Chlorophyll a-b binding protein, chloroplastic × 2 （A8JF10） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic (Lhca4) × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 396 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 30 BETA-CAROTENE × 56 IRON/SULFUR CLUSTER × 6 DODECYL-ALPHA-D-MALTOSIDE × 66 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 30 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 36 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 CHLOROPHYLL B × 60 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 4 water × 32	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8ITV3_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 9； PDBConstruct 1–213； UniProt 1–213 Author chain 92； PDBConstruct 1–213； UniProt 1–213

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7zqd
Deposition date deposition_date	2022-04-29
Last revision last_revision	2022-11-23
Structure title title	Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution
Keywords keywords	Photosynthesis, green algae, dimeric PSI; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7zqd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7zqd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7zqd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	105.80 Å
Total Rg	105.30 Å
Atom count	202658
Residues	8418
Excluded volume	1901200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7zqd__assembly_1__model_1`	40-meric （40）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (33)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83239.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,A2
Atom count atom_count	202818

MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82184.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,B2

MATKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8869.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,C2

MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	21372.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,D2

MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	10786.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,E2

MQALSSRVNIAAKPQRAQRLVVRAEEVKAAPKKEVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	24088.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,F2

MALTMRNPAVKASSRVAPSSRRALRVACQAQKNETASKVGTALAASALAAAVSLSAPSAAMADIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	13236.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,G2

MQTLASRPSLRASARVAPRRAPRVAVVTKAALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	10586.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,I2

MALRAVSAKSAVRPTVARASVKPVAALKPAQKMALAGAASVALLAASSSSAEASQVIATVASAAQGYPFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAPSS

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4645.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,J2

MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFS

Entity 10 Entity 10 polymer

Description description	PSI subunit V
Molecular weight formula_weight	20300.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,L2

MAVAMRSSTGLRATAARRQMPLGLGRVSTVRVCAADTKKAQVISPVNGDPFVGMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGSAQFQSTPSIGVKTLSGRSVARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQILPYYS

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	11214.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,K2

MQALATRPSAIRPTKAARRSSVVVRADGFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23923.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,Z,12,Z2

MALSMRTLSARTAAPRGFSGRRVAAVSNGSRVTMKAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	32629.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,32

MMLTKSAQAAFSGKVARPAKANRARLVCRAEEKSIAKVDRSKDQLYVGASQSSLAYLDGSLPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFAGRVSGSSQPWRPHGWWRRRYRSVAALALIRNRSVC

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	26248.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7,72

MALSMIAQRRAGAFSARQAPRAVRAQAAVRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSIPIA

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25948.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8,82

MALTMKRSGVAARSASSRKSVVTCVARQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic (Lhca4)
Molecular weight formula_weight	28729.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,42

MAFVLAKSSAFGVAAKPVSRRSSVAVKASAVPENVKEAREWIDAWKSKSGGAKRDAALPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLARL

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28257.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,52

MAALMQKSALSRPACSTRSSRRAVVVRAAADRKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGSQ

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27812.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6,62

MMLVAKNAVAARPSARSARRSVVAKASSRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Entity 19 Entity 19 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	22867.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9,92

MIAAKSQVALGRRAPVRGQRVVAAASARPTWLPGLNPPAHLKGALAGDNGFDPLGLGQDEGRLKWYAEAEKTNGRWAMMAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIVMGFLEIKRYQGFKQTGTSGFINSFPFDPAGMNSPSMATKEVKNGRLAMVAFIGFCVQALATRTQPIEGLTAHLADPFGKNITYYLTHLPETLGSA

Entity 20 Entity 20 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	396

Entity 22 Entity 22 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 23 Entity 23 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	30

Entity 24 Entity 24 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	56

Entity 25 Entity 25 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 26 Entity 26 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	66

Entity 27 Entity 27 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	30

Entity 28 Entity 28 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	36

Entity 29 Entity 29 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	60

Entity 31 Entity 31 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 32 Entity 32 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 33 Entity 33 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	160

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.97 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17439

Dimeric PSI of Chlamydomonas reinhardtii at 2.97 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit V, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PSI subunit V

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer